6FDZ: Unc-51-Like Kinase 3

Unc-51-Like Kinase 3 (ULK3) In Complex With Momelotinib. Determined by X-ray diffraction at 2.55 Å resolution. Released 1 Aug 2018.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,067
Mol. weight: 32.35 kDa
Ligands: C87
Released: 1 Aug 2018

Explore 6FDZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FDZ contains 14 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain U: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	14-22	9	1
β-strand	26-33	8	1
β-strand	40-47	8	1
α-helix	48-50	3
β-strand	51	1	2
α-helix	56-67	12
β-strand	74	1	3
β-strand	77-82	6	1
β-strand	86-92	7	1
β-strand	98	1	3
α-helix	99-105	7
α-helix	111-130	20
α-helix	140-142	3
β-strand	143-145	3	3
α-helix	151-152	2
β-strand	153-155	3	3
β-strand	166	1	2
α-helix	182-185	4
α-helix	194-208	15
α-helix	218-226	9
α-helix	229-234	6
α-helix	241-250	10
α-helix	259-260	2
α-helix	261-265	5
α-helix	268-270	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase ULK3	U	protein	276	Homo sapiens	Q6PHR2 (AlphaFold model)

Sequence of entity 1 (U), FASTA

>6FDZ_1 Serine/threonine-protein kinase ULK3 (chains U)
AGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLT
EIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQL
ASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMA
PEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPLLSR
DCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPS

Ligands and cofactors

ID	Name	Formula	Copies
C87	Momelotinib	C23 H22 N6 O2	1

Primary citation

Unc-51-Like Kinase 3 (ULK3) In Complex With Momelotinib. Mathea, S., Salah, E., Moroglu, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q6PHR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WZX 1.39 Å, ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins
6FDY 1.7 Å, Unc-51-Like Kinase 3 (ULK3) In Complex With Bosutinib

Browse structure collections

About this viewer

MolViewer shows 6FDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.