4WZX: Serine/threonine-protein kinase ULK3

ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins. Determined by X-ray diffraction at 1.39 Å resolution. Released 3 Jun 2015.

Method: X-ray diffraction
Resolution: 1.39 Å
Organism: Homo sapiens
Chains: 2
Atoms: 896
Mol. weight: 13.44 kDa
Ligands: CO
Released: 3 Jun 2015

Explore 4WZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WZX contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	14-21	8
α-helix	26-42	17
α-helix	48-68	21
α-helix	69-70	2
α-helix	73-96	24

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase ULK3	A	protein	95	Homo sapiens	Q6PHR2 (AlphaFold model)
IST1 homolog	E	protein	23	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WZX_1 Serine/threonine-protein kinase ULK3 (chains A)
GPHMGTSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLL
AAEPPGRRRELLHTEVQNLMARAEYLKEQVKMRES

Sequence of entity 2 (E), FASTA

>4WZX_2 IST1 homolog (chains E)
TSASEDIDFDDLSRRFEELKKKT

Ligands and cofactors

ID	Name	Formula	Copies
CO	Cobalt (II) ion	Co	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins. Caballe, A., Wenzel, D.M., Agromayor, M. et al. Elife (2015) 4:e06547-e06547. DOI 10.7554/eLife.06547 · PubMed

Other PDB entries of the same protein (UniProt Q6PHR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FDY 1.7 Å, Unc-51-Like Kinase 3 (ULK3) In Complex With Bosutinib
6FDZ 2.55 Å, Unc-51-Like Kinase 3 (ULK3) In Complex With Momelotinib

Browse structure collections

About this viewer

MolViewer shows 4WZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.