Crystal structure of scFv-SM3 in complex with compound 3. Determined by X-ray diffraction at 1.7 Å resolution. Released 20 Feb 2019.
Explore 6FZQ in 3D Show helices and sheets RCSB PDB PDBe
6FZQ contains 8 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-40 | 7 | 2 |
| β-strand | 44-51 | 8 | 2 |
| α-helix | 54-56 | 3 | |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 64-66 | 3 | |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 76-78 | 3 | |
| β-strand | 80-85 | 6 | 1 |
| α-helix | 90-92 | 3 | |
| β-strand | 94-100 | 7 | 2 |
| β-strand | 108-109 | 2 | 2 |
| β-strand | 113-117 | 5 | 2 |
| β-strand | 1011-1013 | 3 | 3 |
| β-strand | 1016-1019 | 4 | 4 |
| β-strand | 1024-1031 | 8 | 3 |
| β-strand | 1034 | 1 | 3 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1043-1048 | 6 | 4 |
| β-strand | 1052-1058 | 7 | 4 |
| β-strand | 1062-1063 | 2 | 4 |
| α-helix | 1064 | 1 | |
| β-strand | 1071-1076 | 6 | 3 |
| β-strand | 1079-1085 | 7 | 3 |
| α-helix | 1089-1091 | 3 | |
| β-strand | 1093-1100 | 8 | 4 |
| β-strand | 1105-1107 | 3 | 4 |
| β-strand | 1111-1115 | 5 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| scFv-1SM3,scFv-1SM3 | H | protein | 244 | Mus musculus | |
| Mucin-1 | P | protein | 6 | Homo sapiens | P15941 (AlphaFold model) |
>6FZQ_1 scFv-1SM3,scFv-1SM3 (chains H) QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYAT HYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSSSSG GGGSGGGGGSSGSSDIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLF TGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKL TVLG
>6FZQ_2 Mucin-1 (chains P) APDTRP
| ID | Name | Formula | Copies |
|---|---|---|---|
| EEN | 2-deoxy-2-[(difluoroacetyl)amino]-alpha-D-galactopyranose | C8 H13 F2 N O6 | 1 |
Water and common crystallization additives (EDO) are not listed.
Water Sculpts the Distinctive Shapes and Dynamics of the Tumor-Associated Carbohydrate Tn Antigens: Implications for Their Molecular Recognition. Bermejo, I.A., Usabiaga, I., Companon, I. et al. J Am Chem Soc (2018) 140:9952-9960. DOI 10.1021/jacs.8b04801 · PubMed
Other PDB entries of the same protein (UniProt P15941 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6FZQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.