6G2K: HuR RRM3

Structure of HuR RRM3 in complex with RNA (UUUUUU). Determined by X-ray diffraction at 2.01 Å resolution. Released 31 Oct 2018.

Method: X-ray diffraction
Resolution: 2.01 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 2,202
Mol. weight: 30.84 kDa
Released: 31 Oct 2018

Explore 6G2K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6G2K contains 10 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	1
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-277	8	1
β-strand	284-292	9	1
α-helix	295-305	11
β-strand	309-310	2	2
β-strand	313-314	2	2
β-strand	316-319	4	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	3
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-277	8	3
β-strand	284-292	9	3
α-helix	295-305	11
β-strand	309-310	2	4
β-strand	313-314	2	4
β-strand	316-319	4	3
α-helix	320-321	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA (5'-r(pupupupupupu)-3')	R	RNA	6	synthetic construct
ELAV-like protein 1	A, B, C	protein	85	Homo sapiens	Q15717 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>6G2K_1 RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') (chains R)
UUUUUU

Sequence of entity 2 (A, B, C), FASTA

>6G2K_2 ELAV-like protein 1 (chains A, B, C)
MGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMA
IASLNGYRLGDKILQVSFKTNKSHK

Primary citation

HuR biological function involves RRM3-mediated dimerization and RNA binding by all three RRMs. Pabis, M., Popowicz, G.M., Stehle, R. et al. Nucleic Acids Res (2019) 47:1011-1029. DOI 10.1093/nar/gky1138 · PubMed

Other PDB entries of the same protein (UniProt Q15717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GD3 1.35 Å, Structure of HuR RRM3 in complex with RNA (UAUUUA)
4FXV 1.9 Å, Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A…
6GC5 1.9 Å, Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM
6GD2 1.9 Å, Structure of HuR RRM3 in complex with RNA
3HI9 2.0 Å, The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich…
4ED5 2.0 Å, Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
6GD1 2.01 Å, Structure of HuR RRM3
4EGL 2.9 Å, Crystal structure of two tandem RNA recognition motifs of Human antigen R
9W2F 3.4 Å, Cryo-EM structure of DDB1-CRBN in complex with dHuR-2 and HuR
5SZW NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR

Browse structure collections

About this viewer

MolViewer shows 6G2K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.