6GD3: HuR RRM3

Structure of HuR RRM3 in complex with RNA (UAUUUA). Determined by X-ray diffraction at 1.35 Å resolution. Released 31 Oct 2018.

Method: X-ray diffraction
Resolution: 1.35 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 2,425
Mol. weight: 30.96 kDa
Released: 31 Oct 2018

Explore 6GD3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GD3 contains 9 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	1
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-277	8	1
β-strand	284-292	9	1
α-helix	295-305	11
β-strand	309-310	2	2
β-strand	313-314	2	2
β-strand	316-318	3	1

Chains B and C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	3
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-277	8	3
β-strand	284-292	9	3
α-helix	295-305	11
β-strand	309-310	2	4
β-strand	313-314	2	4
β-strand	316-319	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ELAV-like protein 1	A, B, C	protein	87	Homo sapiens	Q15717 (AlphaFold model)
RNA (5'-r(pupapupupupa)-3')	P	RNA	6	synthetic construct

Sequence of entity 1 (A, B, C), FASTA

>6GD3_1 ELAV-like protein 1 (chains A, B, C)
GAMGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAA
MAIASLNGYRLGDKILQVSFKTNKSHK

Sequence of entity 2 (P), FASTA

>6GD3_2 RNA (5'-R(P*UP*AP*UP*UP*UP*A)-3') (chains P)
UAUUUA

Primary citation

HuR biological function involves RRM3-mediated dimerization and RNA binding by all three RRMs. Pabis, M., Popowicz, G.M., Stehle, R. et al. Nucleic Acids Res (2019) 47:1011-1029. DOI 10.1093/nar/gky1138 · PubMed

Other PDB entries of the same protein (UniProt Q15717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FXV 1.9 Å, Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A…
6GC5 1.9 Å, Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM
6GD2 1.9 Å, Structure of HuR RRM3 in complex with RNA
3HI9 2.0 Å, The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich…
4ED5 2.0 Å, Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
6G2K 2.01 Å, Structure of HuR RRM3 in complex with RNA (UUUUUU)
6GD1 2.01 Å, Structure of HuR RRM3
4EGL 2.9 Å, Crystal structure of two tandem RNA recognition motifs of Human antigen R
9W2F 3.4 Å, Cryo-EM structure of DDB1-CRBN in complex with dHuR-2 and HuR
5SZW NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR

Browse structure collections

About this viewer

MolViewer shows 6GD3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.