6GC5: ELAV-like protein 1

Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 8
Atoms: 2,839
Mol. weight: 53.21 kDa
Released: 30 Jan 2019

Explore 6GC5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GC5 contains 13 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	1
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-277	8	1
β-strand	284-292	9	1
α-helix	295-305	11
β-strand	309-310	2	2
β-strand	313-314	2	2
β-strand	316-319	4	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	3
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-277	8	3
β-strand	284-292	9	3
α-helix	295-305	11
β-strand	309-310	2	4
β-strand	313-314	2	4
β-strand	316-319	4	3
α-helix	320-321	2

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	5
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-278	9	5
β-strand	283-292	10	5
α-helix	295-305	11
β-strand	309-310	2	6
β-strand	313-314	2	6
β-strand	316-319	4	5

Chain D: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	244-249	6	7
α-helix	257-264	8
α-helix	265-267	3
β-strand	270-275	6	7
β-strand	287-292	6	7
α-helix	295-305	11
β-strand	309-310	2	8
β-strand	313-314	2	8
β-strand	316-319	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ELAV-like protein 1	A, B, C, D	protein	90	Homo sapiens	Q15717 (AlphaFold model)
AU-rich RNA	E, F, G, H	RNA	11	Homo sapiens

Sequence of entity 1 (A, B, C, D), FASTA

>6GC5_1 ELAV-like protein 1 (chains A, B, C, D)
GAMGSSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYE
EAAMAIASLNGYRLGDKILQVSFKTNKSHK

Sequence of entity 2 (E, F, G, H), FASTA

>6GC5_2 AU-rich RNA (chains E, F, G, H)
AUUUUUAUUUU

Primary citation

Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM. Ripin, N., Boudet, J., Duszczyk, M.M. et al. Proc Natl Acad Sci U S A (2019) 116:2935-2944. DOI 10.1073/pnas.1808696116 · PubMed

Other PDB entries of the same protein (UniProt Q15717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GD3 1.35 Å, Structure of HuR RRM3 in complex with RNA (UAUUUA)
4FXV 1.9 Å, Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A…
6GD2 1.9 Å, Structure of HuR RRM3 in complex with RNA
3HI9 2.0 Å, The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich…
4ED5 2.0 Å, Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
6G2K 2.01 Å, Structure of HuR RRM3 in complex with RNA (UUUUUU)
6GD1 2.01 Å, Structure of HuR RRM3
4EGL 2.9 Å, Crystal structure of two tandem RNA recognition motifs of Human antigen R
9W2F 3.4 Å, Cryo-EM structure of DDB1-CRBN in complex with dHuR-2 and HuR
5SZW NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR

Browse structure collections

About this viewer

MolViewer shows 6GC5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.