6GBG: Helicobacter pylori adhesin HopQ type I

Helicobacter pylori adhesin HopQ type I bound to the N-terminal domain of human CEACAM1. Determined by X-ray diffraction at 2.8 Å resolution. Released 27 Jun 2018.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, Helicobacter pylori (strain G27)
Chains: 2
Atoms: 3,291
Mol. weight: 57.42 kDa
Released: 27 Jun 2018

Explore 6GBG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GBG contains 20 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	55-72	18
α-helix	78-97	20
α-helix	98-100	3
β-strand	101	1	4
β-strand	103	1	5
β-strand	106	1	6
α-helix	110-112	3
β-strand	116-120	5	7
β-strand	128-132	5	7
β-strand	135-137	3	3
β-strand	142-143	2	3
α-helix	147-149	3
β-strand	151	1	6
β-strand	158	1	5
α-helix	160-175	16
α-helix	176-180	5
α-helix	182-184	3
β-strand	191-200	10	7
β-strand	208-217	10	7
α-helix	220-237	18
α-helix	239	1
β-strand	240	1	8
β-strand	241	1	4
α-helix	242	1
α-helix	261-264	4
β-strand	268	1	8
α-helix	269-272	4
α-helix	274-299	26
α-helix	316-351	36
α-helix	388-404	17
α-helix	406-419	14

Chain D: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	17-22	6	1
β-strand	28-35	8	3
α-helix	41-43	3
β-strand	44-49	6	3
α-helix	50-52	3
β-strand	54-57	4	3
β-strand	65-67	3	1
β-strand	73-75	3	1
α-helix	80-82	3
β-strand	84-92	9	3
β-strand	96-104	9	3
β-strand	105-107	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Carcinoembryonic antigen-related cell adhesion molecule 1	D	protein	115	Homo sapiens	P13688 (AlphaFold model)
Outer membrane protein	A	protein	411	Helicobacter pylori (strain G27)	B5Z8H1 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>6GBG_1 Carcinoembryonic antigen-related cell adhesion molecule 1 (chains D)
MQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGP
ANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPHHHHHH

Sequence of entity 2 (A), FASTA

>6GBG_2 Outer membrane protein (chains A)
MNADKVQKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAYQ
ATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNGT
HSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSKY
QQDNQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTNNANTPSWQ
TAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNLNSPSSLTA
LAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMTMQNQKNNW
GNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNHHHHHH

Primary citation

Helicobacter pyloriadhesin HopQ disruptstransdimerization in human CEACAMs. Moonens, K., Hamway, Y., Neddermann, M. et al. EMBO J (2018) 37. DOI 10.15252/embj.201798665 · PubMed

Other PDB entries of the same protein (UniProt P13688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MU8 1.7 Å, Structure of the minimally glycosylated human CEACAM1 N-terminal domain
6XO1 1.76 Å, Crystal structure of N97A mutant of human CEACAM1
23VF 1.79 Å, Crystal structure of CEACAM1 in complex with MG1124 antibody
6XNO 1.9 Å, Crystal structure of E99A mutant of human CEACAM1
6XNW 1.9 Å, Crystal structure of V39A mutant of human CEACAM1
4QXW 2.04 Å, Crystal structure of the human CEACAM1 membrane distal amino terminal (N)-domain
9U94 2.11 Å, Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1
2GK2 2.2 Å, Crystal structure of the N terminal domain of human CEACAM1
7RPP 2.2 Å, Crystal structure of human CEACAM1 with GFCC' and ABED face
4WHD 2.5 Å, Human CEACAM1 N-domain homodimer
6GBH 2.59 Å, Helicobacter pylori adhesin HopQ type II bound to the N-terminal domain of human CEACAM1
6AW2 2.68 Å, Crystal structure of the HopQ-CEACAM1 complex

Browse structure collections

About this viewer

MolViewer shows 6GBG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.