Human AURKC INCENP complex bound to BRD-7880. Determined by X-ray diffraction at 1.75 Å resolution. Released 15 May 2019.
Explore 6GR8 in 3D Show helices and sheets RCSB PDB PDBe
6GR8 contains 24 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 1 |
| β-strand | 55-62 | 8 | 1 |
| β-strand | 68-75 | 8 | 1 |
| α-helix | 76-82 | 7 | |
| α-helix | 85-97 | 13 | |
| β-strand | 103 | 1 | 2 |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 115-120 | 6 | 1 |
| β-strand | 126-127 | 2 | 2 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 2 |
| β-strand | 180-182 | 3 | 2 |
| β-strand | 189-190 | 2 | 3 |
| β-strand | 196 | 1 | 4 |
| α-helix | 203-205 | 3 | |
| α-helix | 208-211 | 4 | |
| β-strand | 216 | 1 | 4 |
| α-helix | 220-234 | 15 | |
| α-helix | 244-252 | 9 | |
| α-helix | 264-273 | 10 | |
| α-helix | 278-280 | 3 | |
| α-helix | 282-283 | 2 | |
| α-helix | 284-289 | 6 | |
| α-helix | 291-296 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 841-843 | 3 | |
| α-helix | 844-846 | 3 | |
| α-helix | 848-860 | 13 | |
| α-helix | 865-869 | 5 | |
| α-helix | 873-875 | 3 | |
| α-helix | 877-881 | 5 | |
| α-helix | 886-889 | 4 | |
| α-helix | 893-895 | 3 | |
| α-helix | 900-901 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aurora kinase C | A | protein | 274 | Homo sapiens | Q9UQB9 (AlphaFold model) |
| Inner centromere protein | B | protein | 70 | Homo sapiens | Q9NQS7 (AlphaFold model) |
>6GR8_1 Aurora kinase C (chains A) GANSRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRRE IEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSDKLDEQRTATIIEELA DALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMI EGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLIS RLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCA
>6GR8_2 Inner centromere protein (chains B) MEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTS SAVWNSPPLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| F8Z | 1-[(2~{R},3~{S})-2-[[1,3-benzodioxol-5-ylmethyl(methyl)amino]methyl]-3-methyl-6… | C32 H38 N4 O7 | 1 |
AURKC INCENP complex bound to BRD-7880. Abdul Azeez, K.R., Elkins, J.M. To be published.
Other PDB entries of the same protein (UniProt Q9UQB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GR8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.