6GR9: Human AURKC INCENP complex

Human AURKC INCENP complex bound to VX-680. Determined by X-ray diffraction at 2.25 Å resolution. Released 15 May 2019.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,812
Mol. weight: 41.03 kDa
Ligands: VX6
Released: 15 May 2019

Explore 6GR9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GR9 contains 23 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3
β-strand	43-48	6	1
α-helix	50-52	3
β-strand	53	1	2
β-strand	55	1	2
β-strand	56-62	7	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-96	12
β-strand	103	1	3
β-strand	106-111	6	1
β-strand	115-120	6	1
β-strand	126-127	2	3
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	4
α-helix	169-171	3
β-strand	172-174	3	3
β-strand	180-182	3	3
β-strand	189-190	2	4
β-strand	196	1	5
α-helix	203-205	3
α-helix	208-211	4
β-strand	216	1	5
α-helix	220-234	15
α-helix	244-252	9
α-helix	264-273	10
α-helix	278-280	3
α-helix	282-283	2
α-helix	284-288	5
α-helix	291-296	6
α-helix	301-303	3

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	844-846	3
α-helix	848-860	13
α-helix	865-869	5
α-helix	873-875	3
α-helix	877-881	5
α-helix	893-895	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aurora kinase C	A	protein	274	Homo sapiens	Q9UQB9 (AlphaFold model)
Inner centromere protein	B	protein	70	Homo sapiens	Q9NQS7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6GR9_1 Aurora kinase C (chains A)
GANSRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRRE
IEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSDKLDEQRTATIIEELA
DALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMI
EGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLIS
RLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCA

Sequence of entity 2 (B), FASTA

>6GR9_2 Inner centromere protein (chains B)
MEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTS
SAVWNSPPLQ

Ligands and cofactors

ID	Name	Formula	Copies
VX6	Cyclopropanecarboxylic acid {4-[4-(4-methyl-piperazin-1-yl)-6-(5-methyl-2H-pyra…	C23 H28 N8 O S	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

AURKC INCENP complex bound to BRD-7880. Abdul Azeez, K.R., Elkins, J.M. To be published.

Other PDB entries of the same protein (UniProt Q9UQB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GR8 1.75 Å, Human AURKC INCENP complex bound to BRD-7880
9ESA 2.8 Å, Aurora-C with SER mutation in complex with INCENP peptide

Browse structure collections

About this viewer

MolViewer shows 6GR9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.