6GSE: PDB entry 6GSE

Solution structure of the capsid domain from the activity-regulated cytoskeleton-associated protein, Arc. Determined by solution NMR. Released 22 May 2019.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,344
Mol. weight: 19 kDa
Released: 22 May 2019

Explore 6GSE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GSE contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	211-214	4
α-helix	218-231	14
α-helix	235-245	11
α-helix	249-257	9
α-helix	264-288	25
α-helix	290-293	4
α-helix	298-312	15
α-helix	318-325	8
α-helix	326-328	3
α-helix	331-335	5
α-helix	340-342	3
α-helix	345-360	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Activity-regulated cytoskeleton-associated protein	A	protein	159	Rattus norvegicus	Q63053 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6GSE_1 Activity-regulated cytoskeleton-associated protein (chains A)
SPGLDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWV
EFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDAEEEEIIQYV
VGTLQPKFKRFLRHPLPKTLEQLIQRGMEVQDGLEQAAE

Primary citation

The Capsid Domain of Arc Changes Its Oligomerization Propensity through Direct Interaction with the NMDA Receptor. Nielsen, L.D., Pedersen, C.P., Erlendsson, S. et al. Structure (2019) 27:1071-1081.e5. DOI 10.1016/j.str.2019.04.001 · PubMed

Other PDB entries of the same protein (UniProt Q63053 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X3I 1.8 Å, The crystal structure of Arc N-lobe complexed with CAMK2A fragment
4X3X 2.0 Å, The crystal structure of Arc C-lobe
4X3H 2.4 Å, Crystal structure of arc N-lobe complexed with stargazin peptide
7R24 2.7 Å, Crystal structure of rat Arc CTD in complex with two anti-Arc nanobodies

Browse structure collections

About this viewer

MolViewer shows 6GSE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.