6GZD: Human CSNK1A1 with A86

Crystal structure of Human CSNK1A1 with A86. Determined by X-ray diffraction at 2.28 Å resolution. Released 29 Aug 2018.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,865
Mol. weight: 45.22 kDa
Ligands: TCE, LCI
Released: 29 Aug 2018

Explore 6GZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GZD contains 17 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
β-strand	17-25	9	1
β-strand	30-36	7	1
β-strand	42-49	8	1
α-helix	57-67	11
α-helix	74-75	2
β-strand	76-82	7	1
β-strand	85-91	7	1
β-strand	96	1	2
α-helix	97-103	7
α-helix	110-129	20
β-strand	132-133	2	3
α-helix	139-141	3
β-strand	142-144	3	2
α-helix	147-149	3
β-strand	153-155	3	2
β-strand	162-163	2	3
β-strand	165	1	4
α-helix	171	1
β-strand	172	1	4
α-helix	173-175	3
α-helix	190-193	4
α-helix	196-198	3
α-helix	200-216	17
α-helix	229-242	14
α-helix	245-248	4
α-helix	254-265	12
α-helix	270-272	3
α-helix	274-287	14
α-helix	297-304	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Casein kinase I isoform alpha	A	protein	374	Homo sapiens	P48729 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6GZD_1 Casein kinase I isoform alpha (chains A)
MGSSHHHHHHSSGVDLWSHPQFEKGTENLYFQGGGGRMASSSGSKAEFIVGGKYKLGRKI
GSGSFGDIYLATNITNGEEVAVKLESQKARHPQLHYESKLYKILQGGVGIPHIRWYGQEK
DYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFL
MGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDD
MESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYC
RGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPT
GKQTDKTKSNMKGF

Ligands and cofactors

ID	Name	Formula	Copies
TCE	3,3',3''-phosphanetriyltripropanoic acid	C9 H15 O6 P	1
LCI	[4-[[4-[5-(cyclopropylmethyl)-1-methyl-pyrazol-4-yl]-5-fluoranyl-pyrimidin-2-yl…	C18 H26 F N6	1

Water and common crystallization additives (DMS, PGE, EDO, PEG) are not listed.

Primary citation

Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models. Minzel, W., Venkatachalam, A., Fink, A. et al. Cell (2018) 175:171-185.e25. DOI 10.1016/j.cell.2018.07.045 · PubMed

Other PDB entries of the same protein (UniProt P48729 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FQD 2.45 Å, Structural basis of Lenalidomide induced CK1a degradation by the crl4crbn ubiquitin ligase
10JK 2.8 Å, Structure of Human Argonaute2-miR200b RISC bound to 30nt long target in complex with…
9OTY 3.0 Å, DDB1-CRBN with CK1 alpha, SB-405483, and DEG-47: composite map and model submission
7WTT 3.1 Å, Cryo-EM structure of a human pre-40S ribosomal subunit - State RRP12-A1 (with CK1)
8G66 3.45 Å, Structure with SJ3149
10JI 3.7 Å, Structure of Human Argonaute2-miR200b RISC bound to 14nt long target in complex with…

Browse structure collections

About this viewer

MolViewer shows 6GZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.