A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Aug 2019.
Explore 6H48 in 3D Show helices and sheets RCSB PDB PDBe
6H48 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 181-195 | 15 | |
| α-helix | 202-225 | 24 | |
| α-helix | 243-244 | 2 | |
| α-helix | 245-249 | 5 | |
| α-helix | 250-264 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Orf20 | A | protein | 96 | Staphylococcus aureus | Q9F0J8 (AlphaFold model) |
>6H48_1 Orf20 (chains A) GPGKKREVTIEEIGEFHEKYLKLLFTNLETHNDRKKALAEIEKLKEESIYLGEKLRLVPN HHYDAIKGKPMYKLYLYEYPDRLEHQKKIILEKDTN
The structure of a polygamous repressor reveals how phage-inducible chromosomal islands spread in nature. Rafael Ciges-Tomas, J., Alite, C., Humphrey, S. et al. Nat Commun (2019) 10:3676-3676. DOI 10.1038/s41467-019-11504-2 · PubMed
Other PDB entries of the same protein (UniProt Q9F0J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6H48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.