A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Aug 2019.
Explore 6H49 in 3D Show helices and sheets RCSB PDB PDBe
6H49 contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9 | 1 | 1 |
| α-helix | 13-24 | 12 | |
| α-helix | 29-36 | 8 | |
| α-helix | 40-48 | 9 | |
| α-helix | 52-53 | 2 | |
| β-strand | 54 | 1 | 1 |
| α-helix | 57-65 | 9 | |
| α-helix | 69-82 | 14 | |
| α-helix | 86-89 | 4 | |
| α-helix | 91-107 | 17 | |
| α-helix | 109-114 | 6 | |
| α-helix | 118-131 | 14 | |
| α-helix | 136-138 | 3 | |
| α-helix | 141-152 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Orf20 | A | protein | 157 | Staphylococcus aureus | Q9F0J8 (AlphaFold model) |
>6H49_1 Orf20 (chains A) GMEGAGQMAELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIE IYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLY DETIKLLELLKESKINVNDIDYDYVLKLYKQILSTDT
The structure of a polygamous repressor reveals how phage-inducible chromosomal islands spread in nature. Rafael Ciges-Tomas, J., Alite, C., Humphrey, S. et al. Nat Commun (2019) 10:3676-3676. DOI 10.1038/s41467-019-11504-2 · PubMed
Other PDB entries of the same protein (UniProt Q9F0J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6H49 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.