6H7X: RuvB-like 2

First X-ray structure of full-length human RuvB-Like 2. Determined by X-ray diffraction at 2.89 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.89 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,962
Mol. weight: 51.84 kDa
Ligands: MG
Released: 8 Aug 2018

Explore 6H7X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H7X contains 19 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	50-65	16
β-strand	72-77	6	1
α-helix	83-94	12
β-strand	100-104	5	1
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-140	14	2
β-strand	141-145	5	3
β-strand	161-164	4	3
β-strand	169-172	4	3
α-helix	176-183	8
β-strand	191-194	4	2
β-strand	199	1	2
β-strand	233-243	11	2
α-helix	244-251	8
α-helix	259-262	4
α-helix	267-269	3
α-helix	270-285	16
β-strand	289-293	5	2
β-strand	295-299	5	1
α-helix	301-303	3
β-strand	305	1	4
α-helix	306-315	10
β-strand	323-328	6	1
β-strand	332-334	3	5
β-strand	336	1	4
β-strand	341-343	3	5
α-helix	348-351	4
β-strand	354-359	6	1
α-helix	360-362	3
α-helix	364-378	15
β-strand	382	1	6
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	6
α-helix	423-432	10
α-helix	436-439	4
α-helix	444-454	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like 2	A	protein	463	Homo sapiens	Q9Y230 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6H7X_1 RuvB-like 2 (chains A)
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTT
PYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3

Water and common crystallization additives (EDO, PEG) are not listed.

Primary citation

X-ray structure of full-length human RuvB-Like 2 - mechanistic insights into coupling between ATP binding and mechanical action. Silva, S.T.N., Brito, J.A., Arranz, R. et al. Sci Rep (2018) 8:13726-13726. DOI 10.1038/s41598-018-31997-z · PubMed

Other PDB entries of the same protein (UniProt Q9Y230 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9EMA 2.4 Å, RUVBL1/2 in complex with ATP and CB-6644 inhibitor
6K0R 2.5 Å, Ruvbl1-Ruvbl2 with truncated domain II in complex with phosphorylated Cordycepin
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
3UK6 2.95 Å, Crystal Structure of the Tip48 (Tip49b) hexamer
2XSZ 3.0 Å, The dodecameric human RuvBL1:RuvBL2 complex with truncated domains II
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
7ZI4 3.2 Å, Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex

Browse structure collections

About this viewer

MolViewer shows 6H7X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.