6HAZ: Bromodomain of human SMARCA2

Crystal structure of the bromodomain of human SMARCA2 in complex with SMARCA-BD ligand. Determined by X-ray diffraction at 1.31 Å resolution. Released 12 Jun 2019.

Method: X-ray diffraction
Resolution: 1.31 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,243
Mol. weight: 29.44 kDa
Ligands: ZN, FX5
Released: 12 Jun 2019

Explore 6HAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HAZ contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1381-1396	16
β-strand	1398	1	1
β-strand	1404	1	1
α-helix	1407-1409	3
α-helix	1412-1414	3
α-helix	1419-1424	6
α-helix	1431-1439	9
α-helix	1446-1463	18
α-helix	1465	1
α-helix	1469-1489	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable global transcription activator SNF2L2	A, B	protein	123	Homo sapiens	P51531 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6HAZ_1 Probable global transcription activator SNF2L2 (chains A, B)
SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVD
FKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAK
EEE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
FX5	2-(6-azanyl-5-piperazin-4-ium-1-yl-pyridazin-3-yl)phenol	C14 H18 N5 O	2

Primary citation

BAF complex vulnerabilities in cancer demonstrated via structure-based PROTAC design. Farnaby, W., Koegl, M., Roy, M.J. et al. Nat Chem Biol (2019) 15:672-680. DOI 10.1038/s41589-019-0294-6 · PubMed

Other PDB entries of the same protein (UniProt P51531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
7Z78 1.32 Å, Crystal structure of compound 4 in complex with the bromodomain of human SMARCA2 and…
5DKC 1.6 Å, Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with PFI-3…
9D11 1.68 Å, Smarca2 Bromodomain in complex with compound 22
5DKH 1.7 Å, Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with a…
9E30 1.71 Å, Discovery of Potent, Highly Selective and Efficacious SMARCA2 Degraders - Compound 13
9E31 1.96 Å, Discovery of Potent, Highly Selective and Efficacious SMARCA2 Degraders - Compound 6
4QY4 1.97 Å, Crystal structure of the bromodomain of human SMARCA2
7Z77 1.97 Å, Crystal structure of compound 6 in complex with the bromodomain of human SMARCA2 and…
9QAC 2.07 Å, Crystal structure of the SMARCA2 bromodomain bound to a fragment screening hit
9QAD 2.08 Å, Crystal structure of the SMARCA2 bromodomain bound to a tricyclic pyrimidoindolone…
9D12 2.1 Å, Smarca2 Bromodomain in complex with compound 15

Browse structure collections

About this viewer

MolViewer shows 6HAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.