9E30: PDB entry 9E30

Discovery of Potent, Highly Selective and Efficacious SMARCA2 Degraders - Compound 13. Determined by X-ray diffraction at 1.71 Å resolution. Released 18 Dec 2024.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,127
Mol. weight: 44.78 kDa
Ligands: A1A1O, ZN
Released: 18 Dec 2024

Explore 9E30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E30 contains 25 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1378-1380	3
α-helix	1381-1396	16
β-strand	1398	1	1
β-strand	1404	1	1
α-helix	1407-1409	3
α-helix	1412-1414	3
α-helix	1419-1424	6
α-helix	1431-1439	9
α-helix	1446-1463	18
α-helix	1465	1
α-helix	1469-1488	20

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1383-1396	14
β-strand	1398	1	2
β-strand	1404	1	2
α-helix	1407-1409	3
α-helix	1412-1414	3
α-helix	1419-1424	6
α-helix	1431-1439	9
α-helix	1446-1463	18
α-helix	1465	1
α-helix	1469-1487	19

Chain C: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1382-1396	15
β-strand	1398	1	3
β-strand	1404	1	3
α-helix	1407-1409	3
α-helix	1412-1414	3
α-helix	1419-1424	6
α-helix	1431-1439	9
α-helix	1446-1463	18
α-helix	1465	1
α-helix	1469-1489	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform Short of Probable global transcription activator SNF2L2	A, B, C	protein	123	Homo sapiens	P51531 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9E30_1 Isoform Short of Probable global transcription activator SNF2L2 (chains A, B, C)
SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVD
FKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAK
EEE

Ligands and cofactors

ID	Name	Formula	Copies
A1A1O	(12'S)-4'-chloro-10'-(piperidin-4-yl)-5'H-spiro[cyclohexane-1,7'-indolo[1,2-a]q…	C25 H26 Cl N3 O	3
ZN	Zinc ion	Zn	4

Water and common crystallization additives (ACT) are not listed.

Primary citation

Discovery of Potent, Highly Selective, and Efficacious SMARCA2 Degraders. Li, Z., Harikrishnan, L.S., Xu, G. et al. J Med Chem (2025) 68:1134-1154. DOI 10.1021/acs.jmedchem.4c01878 · PubMed

Other PDB entries of the same protein (UniProt P51531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HAZ 1.31 Å, Crystal structure of the bromodomain of human SMARCA2 in complex with SMARCA-BD ligand
7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
7Z78 1.32 Å, Crystal structure of compound 4 in complex with the bromodomain of human SMARCA2 and…
5DKC 1.6 Å, Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with PFI-3…
9D11 1.68 Å, Smarca2 Bromodomain in complex with compound 22
5DKH 1.7 Å, Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with a…
9E31 1.96 Å, Discovery of Potent, Highly Selective and Efficacious SMARCA2 Degraders - Compound 6
4QY4 1.97 Å, Crystal structure of the bromodomain of human SMARCA2
7Z77 1.97 Å, Crystal structure of compound 6 in complex with the bromodomain of human SMARCA2 and…
9QAC 2.07 Å, Crystal structure of the SMARCA2 bromodomain bound to a fragment screening hit
9QAD 2.08 Å, Crystal structure of the SMARCA2 bromodomain bound to a tricyclic pyrimidoindolone…
9D12 2.1 Å, Smarca2 Bromodomain in complex with compound 15

Browse structure collections

About this viewer

MolViewer shows 9E30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.