Crystal structure of the SMARCA2 bromodomain bound to a fragment screening hit. Determined by X-ray diffraction at 2.07 Å resolution. Released 18 Jun 2025.
Explore 9QAC in 3D Show helices and sheets RCSB PDB PDBe
9QAC contains 26 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1378-1380 | 3 | |
| α-helix | 1381-1396 | 16 | |
| β-strand | 1398 | 1 | 1 |
| β-strand | 1422 | 1 | 1 |
| α-helix | 1425-1427 | 3 | |
| α-helix | 1430-1432 | 3 | |
| α-helix | 1437-1442 | 6 | |
| α-helix | 1449-1457 | 9 | |
| α-helix | 1464-1481 | 18 | |
| α-helix | 1483 | 1 | |
| α-helix | 1487-1505 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1381-1396 | 16 | |
| β-strand | 1398 | 1 | 2 |
| β-strand | 1422 | 1 | 2 |
| α-helix | 1423-1427 | 5 | |
| α-helix | 1430-1432 | 3 | |
| α-helix | 1437-1442 | 6 | |
| α-helix | 1449-1457 | 9 | |
| α-helix | 1464-1481 | 18 | |
| α-helix | 1483 | 1 | |
| α-helix | 1487-1506 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1377-1380 | 4 | |
| α-helix | 1381-1396 | 16 | |
| β-strand | 1398 | 1 | 3 |
| β-strand | 1422 | 1 | 3 |
| α-helix | 1423-1426 | 4 | |
| α-helix | 1430-1432 | 3 | |
| α-helix | 1437-1442 | 6 | |
| α-helix | 1449-1457 | 9 | |
| α-helix | 1464-1481 | 18 | |
| α-helix | 1483 | 1 | |
| α-helix | 1487-1506 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Probable global transcription activator SNF2L2 | A, B, C | protein | 123 | Homo sapiens | P51531 (AlphaFold model) |
>9QAC_1 Probable global transcription activator SNF2L2 (chains A, B, C) SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVD FKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAK EEE
Discovery of Pyrimidoindolones as Novel Family VIII Bromodomain Binders. Boerth, J.A., Schimpl, M., Lucas, S.C.C. et al. ACS Med Chem Lett (2025) 16:1073-1079. DOI 10.1021/acsmedchemlett.5c00120 · PubMed
Other PDB entries of the same protein (UniProt P51531 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9QAC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.