Influenza A Virus N9 Neuraminidase Native (Tern). Determined by X-ray diffraction at 1.29 Å resolution. Released 29 Aug 2018.
Explore 6HFC in 3D Show helices and sheets RCSB PDB PDBe
6HFC contains 7 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 91-92 | 2 | 1 |
| α-helix | 93-94 | 2 | |
| β-strand | 97-103 | 7 | 2 |
| α-helix | 106-110 | 5 | |
| β-strand | 115 | 1 | 3 |
| β-strand | 116-126 | 11 | 4 |
| β-strand | 129-140 | 12 | 4 |
| α-helix | 144-146 | 3 | |
| β-strand | 158-163 | 6 | 4 |
| β-strand | 169 | 1 | 3 |
| α-helix | 173 | 1 | |
| β-strand | 174-178 | 5 | 4 |
| β-strand | 181-186 | 6 | 5 |
| β-strand | 191-197 | 7 | 5 |
| β-strand | 204-209 | 6 | 5 |
| β-strand | 212-218 | 7 | 5 |
| β-strand | 226 | 1 | 6 |
| β-strand | 235 | 1 | 7 |
| β-strand | 238 | 1 | 7 |
| β-strand | 239-246 | 8 | 6 |
| β-strand | 252-260 | 9 | 6 |
| β-strand | 263-269 | 7 | 6 |
| β-strand | 278-285 | 8 | 8 |
| β-strand | 288-294 | 7 | 8 |
| α-helix | 302 | 1 | |
| β-strand | 303-308 | 6 | 8 |
| β-strand | 313-318 | 6 | 8 |
| α-helix | 330-332 | 3 | |
| β-strand | 354-355 | 2 | 9 |
| β-strand | 362-365 | 4 | 9 |
| β-strand | 373-379 | 7 | 9 |
| β-strand | 393-403 | 11 | 9 |
| β-strand | 407-410 | 4 | 2 |
| β-strand | 419-420 | 2 | 1 |
| β-strand | 423-431 | 9 | 2 |
| β-strand | 441-451 | 11 | 2 |
| α-helix | 466-469 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuraminidase | A | protein | 388 | Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) | P03472 |
>6HFC_1 Neuraminidase (chains A) RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRFYALSQGTTIR GKHSNGTIHDRSQYRALISWPLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVVFTDGSATGPAETRIYYFKEG KILKWEPLAGTAKHIEECSCYGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTWLGRTISIASRSGYEMLKVPN ALTDDKSKPTQGQTIVLNTDWSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS NSIVSMCSSTEFLGQWDWPDGAKIEYFL
Water and common crystallization additives (GOL, K) are not listed.
High Resolution Structures of Viral Neuraminidase with Drugs Bound in the Active Site. (In preparation). Salinger, M.T., Hobbs, J.R., Murray, J.W. et al. To be published.
Other PDB entries of the same protein (UniProt P03472), best resolution first:
MolViewer shows 6HFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.