6HW2: CaV beta4c

The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains. Determined by X-ray diffraction at 1.94 Å resolution. Released 29 Jan 2020.

Method: X-ray diffraction
Resolution: 1.94 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 3
Atoms: 2,299
Mol. weight: 35.17 kDa
Ligands: CA
Released: 29 Jan 2020

Explore 6HW2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HW2 contains 12 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	64-87	24
α-helix	91-92	2
β-strand	94-98	5	1
β-strand	102	1	2
α-helix	104-106	3
β-strand	116	1	1
β-strand	119	1	2
β-strand	124-130	7	1
β-strand	135-140	6	1
β-strand	148-151	4	1
α-helix	153-165	13
β-strand	212-215	4	1
β-strand	219-220	2	3
β-strand	221-224	4	4

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	116-119	4
α-helix	121-122	2
β-strand	123-130	8	5
β-strand	137-142	6	5
β-strand	149-152	4	5
α-helix	153-159	7
α-helix	161-171	11
β-strand	173-176	4	4

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	116-119	4
α-helix	121-122	2
β-strand	123-130	8	6
β-strand	137-142	6	6
β-strand	149-152	4	6
α-helix	153-159	7
α-helix	161-171	11
β-strand	172-173	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent L-type calcium channel subunit beta-4	A	protein	154	Rattus norvegicus	D4A055 (AlphaFold model)
Chromobox protein homolog 3	B, C	protein	75	Homo sapiens	Q13185 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6HW2_1 Voltage-dependent L-type calcium channel subunit beta-4 (chains A)
GSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPS
TAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGEF
AKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYE

Sequence of entity 2 (B, C), FASTA

>6HW2_2 Chromobox protein homolog 3 (chains B, C)
DAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFY
EERLTWHSCPEDEAQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (GOL, BME, ACT) are not listed.

Primary citation

The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains. Tanner, N., Tripathy, D.R., Hirsch, J.A. To be published.

Other PDB entries of the same protein (UniProt D4A055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VYV 3.0 Å, beta4 subunit of Ca2+ channel

Browse structure collections

About this viewer

MolViewer shows 6HW2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.