6I41: Speckle-type POZ protein

Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 May 2019.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,209
Mol. weight: 17.55 kDa
Released: 8 May 2019

Explore 6I41 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I41 contains 8 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	29	1	1
β-strand	31-38	8	2
α-helix	41-43	3
β-strand	52-53	2	3
α-helix	54-56	3
β-strand	57-59	3	3
β-strand	60	1	1
α-helix	61-63	3
β-strand	65-72	8	3
α-helix	78-80	3
β-strand	83-92	10	3
β-strand	97-107	11	2
β-strand	113-118	6	2
α-helix	122	1
β-strand	123-126	4	2
β-strand	130-138	9	3
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-165	11	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	247	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A	protein	145	Homo sapiens	O43791 (AlphaFold model)
Bromodomain-containing protein 3	B	protein	9	Homo sapiens	Q15059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I41_1 Speckle-type POZ protein (chains A)
GAMASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK
DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDF
LLDEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (B), FASTA

>6I41_2 Bromodomain-containing protein 3 (chains B)
KADTTTPTT

Primary citation

Structural Insights into BET Client Recognition of Endometrial and Prostate Cancer-Associated SPOP Mutants. Ostertag, M.S., Hutwelker, W., Plettenburg, O. et al. J Mol Biol (2019) 431:2213-2221. DOI 10.1016/j.jmb.2019.04.017 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
9HGG 1.9 Å, SETD2 peptide bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 6I41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.