6J06: Intracellular B30.2 domain of BTN3A1

Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with HMBPP-08. Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Apr 2019.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,891
Mol. weight: 70.52 kDa
Ligands: 99C, FLC, CA
Released: 3 Apr 2019

Explore 6J06 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J06 contains 11 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	298-306	9
β-strand	308-309	2	1
α-helix	310	1
β-strand	314	1	2
α-helix	316-318	3
β-strand	323-325	3	1
β-strand	331-334	4	1
β-strand	353-355	3	3
β-strand	356	1	2
β-strand	360	1	3
β-strand	364-370	7	1
β-strand	377-383	7	3
β-strand	400-406	7	3
β-strand	410-413	4	3
β-strand	419-421	3	3
β-strand	429-435	7	1
β-strand	440-445	6	1
β-strand	451-455	5	1
β-strand	464-469	6	3
α-helix	477	1
β-strand	478-481	4	1
α-helix	482	1

Chain B: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	298-306	9
β-strand	308-309	2	4
β-strand	314	1	5
α-helix	316-318	3
β-strand	323-325	3	4
β-strand	331-334	4	4
β-strand	353-355	3	6
β-strand	356	1	5
β-strand	360	1	6
β-strand	364-370	7	4
β-strand	377-383	7	6
α-helix	396-398	3
β-strand	400-406	7	6
β-strand	410-413	4	6
β-strand	419-421	3	6
β-strand	430-435	6	4
β-strand	440-445	6	4
β-strand	451-455	5	4
β-strand	464-469	6	6
β-strand	478-481	4	4

Chain C: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	298-306	9
β-strand	308-309	2	7
β-strand	314	1	8
α-helix	316-318	3
β-strand	323-325	3	7
β-strand	331-334	4	7
β-strand	353-355	3	9
β-strand	356	1	8
β-strand	360	1	9
β-strand	364-370	7	7
β-strand	377-383	7	9
β-strand	400-406	7	9
β-strand	410-413	4	9
β-strand	419-421	3	9
β-strand	430-435	6	7
β-strand	440-445	6	7
β-strand	451-455	5	7
β-strand	464-469	6	9
α-helix	476-477	2
β-strand	478-481	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A1	A, B, C	protein	196	Homo sapiens	O00481 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6J06_1 Butyrophilin subfamily 3 member A1 (chains A, B, C)
MGAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVL
GCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLT
EPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEP
TALTICPALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
99C	(2E)-3-(hydroxymethyl)-4-(4-methylphenyl)but-2-en-1-yl trihydrogen diphosphate	C12 H18 O8 P2	3
FLC	Citrate anion	C6 H5 O7	1
CA	Calcium ion	Ca	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

A Structural Change in Butyrophilin upon Phosphoantigen Binding Underlies Phosphoantigen-Mediated V gamma 9V delta 2 T Cell Activation. Yang, Y., Li, L., Yuan, L. et al. Immunity (2019) 50:1043. DOI 10.1016/j.immuni.2019.02.016 · PubMed

Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ITA 1.2 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
6ISM 1.25 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
8IZE 1.4 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 4-HMBPP
4N7I 1.4 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1
4N7U 1.46 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 in Complex with CHDMAPP
5LYG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to malonate
8IZG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 5-HMBPP
5LYK 1.7 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to citrate
8IXV 1.72 Å, Crystal structure of intracellular B30.2 domain of BTN3A in complex with 2Cl-HMBPP
4K55 1.91 Å, Structure of the extracellular domain of butyrophilin BTN3A1 in complex with…
5HM7 1.93 Å, The Intracellular domain of Butyrophilin 3A1 protein
4F80 1.94 Å, Crystal Structure of the human BTN3A1 ectodomain

Browse structure collections

About this viewer

MolViewer shows 6J06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.