Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with HMBPP-08. Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Apr 2019.
Explore 6J06 in 3D Show helices and sheets RCSB PDB PDBe
6J06 contains 11 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 298-306 | 9 | |
| β-strand | 308-309 | 2 | 1 |
| α-helix | 310 | 1 | |
| β-strand | 314 | 1 | 2 |
| α-helix | 316-318 | 3 | |
| β-strand | 323-325 | 3 | 1 |
| β-strand | 331-334 | 4 | 1 |
| β-strand | 353-355 | 3 | 3 |
| β-strand | 356 | 1 | 2 |
| β-strand | 360 | 1 | 3 |
| β-strand | 364-370 | 7 | 1 |
| β-strand | 377-383 | 7 | 3 |
| β-strand | 400-406 | 7 | 3 |
| β-strand | 410-413 | 4 | 3 |
| β-strand | 419-421 | 3 | 3 |
| β-strand | 429-435 | 7 | 1 |
| β-strand | 440-445 | 6 | 1 |
| β-strand | 451-455 | 5 | 1 |
| β-strand | 464-469 | 6 | 3 |
| α-helix | 477 | 1 | |
| β-strand | 478-481 | 4 | 1 |
| α-helix | 482 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 298-306 | 9 | |
| β-strand | 308-309 | 2 | 4 |
| β-strand | 314 | 1 | 5 |
| α-helix | 316-318 | 3 | |
| β-strand | 323-325 | 3 | 4 |
| β-strand | 331-334 | 4 | 4 |
| β-strand | 353-355 | 3 | 6 |
| β-strand | 356 | 1 | 5 |
| β-strand | 360 | 1 | 6 |
| β-strand | 364-370 | 7 | 4 |
| β-strand | 377-383 | 7 | 6 |
| α-helix | 396-398 | 3 | |
| β-strand | 400-406 | 7 | 6 |
| β-strand | 410-413 | 4 | 6 |
| β-strand | 419-421 | 3 | 6 |
| β-strand | 430-435 | 6 | 4 |
| β-strand | 440-445 | 6 | 4 |
| β-strand | 451-455 | 5 | 4 |
| β-strand | 464-469 | 6 | 6 |
| β-strand | 478-481 | 4 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 298-306 | 9 | |
| β-strand | 308-309 | 2 | 7 |
| β-strand | 314 | 1 | 8 |
| α-helix | 316-318 | 3 | |
| β-strand | 323-325 | 3 | 7 |
| β-strand | 331-334 | 4 | 7 |
| β-strand | 353-355 | 3 | 9 |
| β-strand | 356 | 1 | 8 |
| β-strand | 360 | 1 | 9 |
| β-strand | 364-370 | 7 | 7 |
| β-strand | 377-383 | 7 | 9 |
| β-strand | 400-406 | 7 | 9 |
| β-strand | 410-413 | 4 | 9 |
| β-strand | 419-421 | 3 | 9 |
| β-strand | 430-435 | 6 | 7 |
| β-strand | 440-445 | 6 | 7 |
| β-strand | 451-455 | 5 | 7 |
| β-strand | 464-469 | 6 | 9 |
| α-helix | 476-477 | 2 | |
| β-strand | 478-481 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Butyrophilin subfamily 3 member A1 | A, B, C | protein | 196 | Homo sapiens | O00481 (AlphaFold model) |
>6J06_1 Butyrophilin subfamily 3 member A1 (chains A, B, C) MGAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVL GCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLT EPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEP TALTICPALEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 99C | (2E)-3-(hydroxymethyl)-4-(4-methylphenyl)but-2-en-1-yl trihydrogen diphosphate | C12 H18 O8 P2 | 3 |
| FLC | Citrate anion | C6 H5 O7 | 1 |
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (SO4) are not listed.
A Structural Change in Butyrophilin upon Phosphoantigen Binding Underlies Phosphoantigen-Mediated V gamma 9V delta 2 T Cell Activation. Yang, Y., Li, L., Yuan, L. et al. Immunity (2019) 50:1043. DOI 10.1016/j.immuni.2019.02.016 · PubMed
Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6J06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.