6J44: Redefined DNA-binding domain of human XPA

Crystal structure of the redefined DNA-binding domain of human XPA. Determined by X-ray diffraction at 2.06 Å resolution. Released 29 May 2019.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,100
Mol. weight: 17.54 kDa
Ligands: ZN
Released: 29 May 2019

Explore 6J44 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J44 contains 8 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	99-101	3
β-strand	103-104	2	1
α-helix	105	1
β-strand	111-112	2	1
α-helix	116-121	6
β-strand	138-140	3	2
α-helix	141-148	8
α-helix	152-156	5
α-helix	161-163	3
β-strand	165-167	3	2
β-strand	178-182	5	2
α-helix	183-194	12
α-helix	197-230	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein complementing XP-A cells	A	protein	145	Homo sapiens	P23025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6J44_1 DNA repair protein complementing XP-A cells (chains A)
GSHMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCD
LEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKM
KQKKFDKKVKELRRAVRSSVWKRET

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structural characterization of the redefined DNA-binding domain of human XPA. Lian, F.M., Yang, X., Yang, W. et al. Biochem Biophys Res Commun (2019) 514:985-990. DOI 10.1016/j.bbrc.2019.05.050 · PubMed

Other PDB entries of the same protein (UniProt P23025 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6LAE 2.81 Å, Crystal structure of the DNA-binding domain of human XPA in complex with DNA
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
8EBU 3.3 Å, XPC release from Core7-XPA-DNA (Cy5)
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
6RO4 3.5 Å, Structure of the core TFIIH-XPA-DNA complex
7AD8 3.5 Å, Core TFIIH-XPA-DNA complex with modelled p62 subunit
9XYU 3.5 Å, NER complex - C7CAD.ATP
28KE 3.6 Å, Cryo-EM structure of the human holo-TFIIH-XPC-XPA complex bound to bulky lesion-mimic DNA
8EBX 3.6 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (AP)
8EBY 3.6 Å, XPC release from Core7-XPA-DNA (AP)
8EBT 3.9 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (Cy5)

Browse structure collections

About this viewer

MolViewer shows 6J44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.