6J68: KIBRA and LATS1 Complex

Structure of KIBRA and LATS1 Complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,270
Mol. weight: 37.93 kDa
Released: 25 Sept 2019

Explore 6J68 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J68 contains 10 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	12-16	5	1
β-strand	22-26	5	1
β-strand	31-33	3	1
α-helix	39-42	4
β-strand	59-64	6	2
β-strand	68-73	6	2
β-strand	78-80	3	2
α-helix	84-126	43

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	12-16	5	3
β-strand	22-26	5	3
β-strand	31-33	3	3
α-helix	39-42	4
α-helix	47-49	3
β-strand	59-61	3	4
β-strand	71-73	3	4
β-strand	78-80	3	4
α-helix	84-124	41

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	548-551	4
α-helix	560-562	3

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	549-551	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein KIBRA	A, B	protein	134	Mus musculus	Q5SXA9 (AlphaFold model)
Peptide from Serine/threonine-protein kinase LATS1	C, D	protein	28	Mus musculus	Q8BYR2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6J68_1 Protein KIBRA (chains A, B)
GPGSEFELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISDELPLG
WEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQ
QRLELAQQEYQQLH

Sequence of entity 2 (C, D), FASTA

>6J68_2 Peptide from Serine/threonine-protein kinase LATS1 (chains C, D)
GPGSVAEAPSYQGPPPPYPKHLLHQNPS

Primary citation

Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity. Lin, Z., Yang, Z., Xie, R. et al. Elife (2019) 8. DOI 10.7554/eLife.49439 · PubMed

Other PDB entries of the same protein (UniProt Q5SXA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJX 2.0 Å, Crystal Structure of KIBRA and Angiomotin complex
6JJY 2.3 Å, Crystal Structure of KIBRA and beta-Dystroglycan
6JJW 2.4 Å, Crystal Structure of KIBRA and PTPN14 complex
6J69 2.75 Å, Structure of KIBRA and Dendrin Complex

Browse structure collections

About this viewer

MolViewer shows 6J68 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.