6J69: KIBRA and Dendrin Complex

Structure of KIBRA and Dendrin Complex. Determined by X-ray diffraction at 2.75 Å resolution. Released 20 Mar 2019.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,158
Mol. weight: 18.79 kDa
Released: 20 Mar 2019

Explore 6J69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J69 contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	12-16	5	1
β-strand	22-26	5	1
β-strand	31-33	3	1
α-helix	39-42	4
α-helix	54-56	3
β-strand	59-64	6	2
β-strand	68-73	6	2
β-strand	78-80	3	2
α-helix	84-123	40

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	224-227	4
β-strand	238	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein KIBRA	A	protein	134	Mus musculus	Q5SXA9 (AlphaFold model)
Peptide from Dendrin	B	protein	25	Mus musculus	Q80TS7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6J69_1 Protein KIBRA (chains A)
GPGSEFELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISDELPLG
WEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQ
QRLELAQQEYQQLH

Sequence of entity 2 (B), FASTA

>6J69_2 Peptide from Dendrin (chains B)
DRPPPYVAPPSYEGPHRTLGTKRGP

Primary citation

Kibra Modulates Learning and Memory via Binding to Dendrin. Ji, Z., Li, H., Yang, Z. et al. Cell Rep (2019) 26:2064-2077.e7. DOI 10.1016/j.celrep.2019.01.097 · PubMed

Other PDB entries of the same protein (UniProt Q5SXA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJX 2.0 Å, Crystal Structure of KIBRA and Angiomotin complex
6JJY 2.3 Å, Crystal Structure of KIBRA and beta-Dystroglycan
6JJW 2.4 Å, Crystal Structure of KIBRA and PTPN14 complex
6J68 2.5 Å, Structure of KIBRA and LATS1 Complex

Browse structure collections

About this viewer

MolViewer shows 6J69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.