6J8N: SVBP-VASH1 complex, mutation C169A of VASH1

Crystal structure of SVBP-VASH1 complex, mutation C169A of VASH1. Determined by X-ray diffraction at 1.95 Å resolution. Released 19 Jun 2019.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,906
Mol. weight: 70.92 kDa
Released: 19 Jun 2019

Explore 6J8N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J8N contains 29 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	27-48	22

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	71-84	14
α-helix	89-95	7
α-helix	101-103	3
α-helix	105-110	6
α-helix	118-131	14
β-strand	134	1	1
β-strand	149	1	2
α-helix	150-163	14
β-strand	167	1	1
α-helix	169-180	12
β-strand	186-197	12	3
β-strand	200-211	12	3
β-strand	214-218	5	3
α-helix	224-226	3
β-strand	229-233	5	3
α-helix	236-249	14
α-helix	252	1
β-strand	253-259	7	3
α-helix	260-264	5
β-strand	272	1	2
α-helix	273	1
β-strand	278-281	4	3
α-helix	282-301	20

Chain D: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	71-84	14
α-helix	89-95	7
α-helix	101-103	3
α-helix	105-110	6
α-helix	118-132	15
β-strand	134	1	4
β-strand	149	1	5
α-helix	150-163	14
β-strand	167	1	4
α-helix	169-180	12
β-strand	186-197	12	6
β-strand	200-211	12	6
β-strand	214-218	5	6
α-helix	224-226	3
β-strand	229-233	5	6
α-helix	236-249	14
α-helix	252	1
β-strand	253-259	7	6
α-helix	261-264	4
α-helix	271	1
β-strand	272	1	5
α-helix	273	1
β-strand	278-281	4	6
α-helix	282-301	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small vasohibin-binding protein	A, C	protein	66	Homo sapiens	Q8N300 (AlphaFold model)
Tubulinyl-Tyr carboxypeptidase 1	B, D	protein	238	Homo sapiens	Q7L8A9 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6J8N_1 Small vasohibin-binding protein (chains A, C)
MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQ
MQPPGE

Sequence of entity 2 (B, D), FASTA

>6J8N_2 Tubulinyl-Tyr carboxypeptidase 1 (chains B, D)
MDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRY
IRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKALEAVILGIYLTNSMPTLER
FPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYG
RCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIG

Primary citation

Molecular basis of vasohibins-mediated detyrosination and its impact on spindle function and mitosis. Liao, S., Rajendraprasad, G., Wang, N. et al. Cell Res (2019) 29:533-547. DOI 10.1038/s41422-019-0187-y · PubMed

Other PDB entries of the same protein (UniProt Q8N300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J4P 1.6 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6J7B 1.62 Å, Crystal structure of VASH1-SVBP in complex with epoY
6OCG 1.83 Å, Crystal structure of VASH1-SVBP complex bound with EpoY
6J8O 1.85 Å, Structure of a hypothetical protease
6J4U 2.0 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6OCH 2.0 Å, Crystal structure of VASH1-SVBP complex bound with parthenolide
6QBY 2.09 Å, Crystal structure of VASH 2 in complex with SVBP
6J4V 2.1 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6NVQ 2.1 Å, Crystal structure of the VASH1-SVBP complex
6OCF 2.1 Å, The crystal structure of VASH1-SVBP complex
6JZC 2.2 Å, Structural basis of tubulin detyrosination
6K81 2.28 Å, Crystal structure of human VASH1-SVBP complex

Browse structure collections

About this viewer

MolViewer shows 6J8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.