6JH0: CISG15/NS1B complex

Crystal structure of cISG15/NS1B complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 16 Oct 2019.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Influenza B virus (strain B/Lee/1940), Canis lupus familiaris
Chains: 4
Atoms: 3,951
Mol. weight: 59.81 kDa
Released: 16 Oct 2019

Explore 6JH0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JH0 contains 30 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	16-36	21
α-helix	42-65	24
α-helix	68-70	3
α-helix	74-90	17
α-helix	93-95	3
α-helix	97-100	4

Chain B: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	5
β-strand	20-24	5	5
β-strand	30	1	6
α-helix	31-42	12
α-helix	46-48	3
β-strand	49-53	5	5
α-helix	58	1
β-strand	59	1	5
α-helix	60-61	2
β-strand	65	1	6
α-helix	67-69	3
β-strand	76-81	6	5
β-strand	88-93	6	7
β-strand	99-104	6	7
β-strand	109	1	8
α-helix	110-121	12
α-helix	125-127	3
β-strand	128-132	5	7
β-strand	135-136	2	7
α-helix	137-138	2
β-strand	142	1	8
α-helix	143-146	4
α-helix	148-149	2
β-strand	153-158	6	7

Chain D: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	20-24	5	1
β-strand	30	1	2
α-helix	31-42	12
α-helix	46-48	3
β-strand	49-53	5	1
α-helix	58	1
β-strand	59	1	1
α-helix	60-61	2
β-strand	65	1	2
α-helix	67-69	3
β-strand	76-81	6	1
β-strand	88-93	6	3
β-strand	99-104	6	3
β-strand	109	1	4
α-helix	110-121	12
α-helix	125-127	3
β-strand	128-132	5	3
β-strand	135-136	2	3
β-strand	142	1	4
α-helix	143-146	4
β-strand	153-158	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, C	protein	103	Influenza B virus (strain B/Lee/1940)	P03502 (AlphaFold model)
ISG15 ubiquitin-like modifier	B, D	protein	163	Canis lupus familiaris	E2R7R1

Sequence of entity 1 (A, C), FASTA

>6JH0_1 Non-structural protein 1 (chains A, C)
MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIK
THNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY

Sequence of entity 2 (B, D), FASTA

>6JH0_2 ISG15 ubiquitin-like modifier (chains B, D)
MLEPTAMAGNLTVKMLGGEEFLVPLRDSMLASELKQQIALKTGVPAFQQRLATHPAGTVL
QDGISLIRQGLCPGSTVLLVVKNSNDPLSILVRNNKGRSIAYEVWLTQTVAELKQQVCQQ
EHVQADLFWLTFEGKPMEDKHQLGEYGLTPQCTVFMNLRLRGG

Primary citation

Crystal structure of cISG15/NS1B complex. Jiang, Y.N., Wang, X.Q. To be published.

Other PDB entries of the same protein (UniProt P03502 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S8S 1.87 Å, Crystal Structure of HLA A*1101 in complex with RVLVNGTFLK, an 10-mer epitope from…
3RT3 2.01 Å, Complex of influenza virus protein with host anti-viral factor
1XEQ 2.1 Å, Crystal tructure of RNA binding domain of influenza B virus non-structural protein
3SDL 2.29 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B…
3R66 2.3 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza…
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
6JH1 3.0 Å, Crystal structure of bISG15/NS1B complex

Browse structure collections

About this viewer

MolViewer shows 6JH0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.