6JH1: BISG15/NS1B complex

Crystal structure of bISG15/NS1B complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 16 Oct 2019.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Influenza B virus (strain B/Lee/1940), Bos taurus
Chains: 4
Atoms: 3,795
Mol. weight: 58.39 kDa
Released: 16 Oct 2019

Explore 6JH1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JH1 contains 22 α-helices and 25 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-36	21
α-helix	42-64	23
α-helix	68-70	3
α-helix	74-89	16
α-helix	93-95	3

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-35	20
α-helix	42-64	23
α-helix	68-70	3
α-helix	74-90	17
α-helix	93-95	3

Chain C: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	5
β-strand	14-17	4	5
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	5
α-helix	52	1
β-strand	53	1	5
α-helix	54-55	2
β-strand	70-75	6	5
β-strand	79-84	6	6
β-strand	90-95	6	6
β-strand	100	1	7
α-helix	101-112	12
β-strand	120-122	3	6
β-strand	127	1	6
α-helix	128-129	2
β-strand	133	1	7
α-helix	135-137	3
β-strand	144-148	5	6

Chain D: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	1
β-strand	14-17	4	1
β-strand	24	1	2
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	1
α-helix	52-55	4
β-strand	59	1	2
β-strand	70-75	6	1
β-strand	78-84	7	3
β-strand	90-96	7	3
β-strand	100	1	4
α-helix	101-111	11
β-strand	120-123	4	3
β-strand	126-127	2	3
β-strand	133	1	4
α-helix	134-137	4
β-strand	144-148	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	103	Influenza B virus (strain B/Lee/1940)	P03502 (AlphaFold model)
Ubiquitin-like protein ISG15	C, D	protein	154	Bos taurus	O02741 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6JH1_1 Non-structural protein 1 (chains A, B)
MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIK
THNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY

Sequence of entity 2 (C, D), FASTA

>6JH1_2 Ubiquitin-like protein ISG15 (chains C, D)
MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPL
VLQGLRAGSTVLLVVQNSISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFW
LSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG

Primary citation

Crystal structure of bISG15/NS1B complex. Jiang, Y.N., Wang, X.Q. To be published.

Other PDB entries of the same protein (UniProt P03502 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S8S 1.87 Å, Crystal Structure of HLA A*1101 in complex with RVLVNGTFLK, an 10-mer epitope from…
3RT3 2.01 Å, Complex of influenza virus protein with host anti-viral factor
1XEQ 2.1 Å, Crystal tructure of RNA binding domain of influenza B virus non-structural protein
3SDL 2.29 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B…
3R66 2.3 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza…
6JH0 2.4 Å, Crystal structure of cISG15/NS1B complex
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex

Browse structure collections

About this viewer

MolViewer shows 6JH1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.