6JQK: C34M/N36
Structure of C34M/N36. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Apr 2020.
- Method
- X-ray diffraction
- Resolution
- 1.5 Å
- Organism
- Human immunodeficiency virus 1
- Chains
- 2
- Atoms
- 649
- Mol. weight
- 8.37 kDa
- Released
- 8 Apr 2020
Explore 6JQK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6JQK contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 629-660 | 32 | |
Chain N: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 547-580 | 34 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| N36 | N | protein | 37 | Human immunodeficiency virus 1 | P04578 (AlphaFold model) |
| C34M | C | protein | 35 | Human immunodeficiency virus 1 | P04578 (AlphaFold model) |
Sequence of entity 1 (N), FASTA
>6JQK_1 N36 (chains N)
XSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL
Sequence of entity 2 (C), FASTA
>6JQK_2 C34M (chains C)
XWASLWNWFNNYTSLIHSLIEESQNQQEKNEQELL
Primary citation
Structure of C34M/N36. Yu, D.W., Qin, B. To be published.
Other PDB entries of the same protein (UniProt P04578 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8F3A 1.2 Å, HIV-1 gp41 coiled-coil pocket IQN17
- 6UCF 1.29 Å, N123-VRC34_pI4 HIV neutralizing antibody in complex with HIV fusion peptide residue…
- 6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
- 6UCE 1.38 Å, N123-VRC34_pI3 HIV neutralizing antibody in complex with HIV fusion peptide residue…
- 9ARN 1.41 Å, Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal…
- 1DF4 1.45 Å, Interactions between HIV-1 GP41 core and detergents and their implications for membrane…
- 6BXP 1.45 Å, Crystal Structure of HLA-B*57:01 with a modified HIV peptide RKV-Kyn
- 7EKB 1.45 Å, Crystal structure of 4E10 modified with pyrene acetamide
- 5X08 1.49 Å, Crystal structure of broadly neutralizing anti-HIV-1 antibody 4E10, mutant Npro, with…
- 5TKK 1.55 Å, Structure of mouse vaccination-elicited HIV neutralizing antibody vFP5.01 in complex…
- 6PDR 1.55 Å, Vaccine-elicited murine FP-targeting antibody vFP25.18 in complex with HIV fusion…
- 6BXQ 1.58 Å, Crystal Structure of HLA-B*57:01 with an HIV peptide RKV
Browse structure collections
About this viewer
MolViewer shows 6JQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.