6K71: EIF2 - eIF2B complex
eIF2 - eIF2B complex. Determined by electron microscopy at 4.3 Å resolution. Released 10 Jul 2019.
- Method
- Electron microscopy
- Resolution
- 4.3 Å
- Organism
- Homo sapiens
- Chains
- 13
- Atoms
- 32,589
- Mol. weight
- 648.2 kDa
- Released
- 10 Jul 2019
Explore 6K71 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6K71 contains 159 α-helices and 243 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 17 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-16 | 9 | |
| α-helix | 22-32 | 11 | |
| α-helix | 33-35 | 3 | |
| α-helix | 47-57 | 11 | |
| α-helix | 64-76 | 13 | |
| α-helix | 93-105 | 13 | |
| α-helix | 107-114 | 8 | |
| β-strand | 124-127 | 4 | 1 |
| α-helix | 132-142 | 11 | |
| β-strand | 149-152 | 4 | 1 |
| β-strand | 153 | 1 | 2 |
| α-helix | 162-169 | 8 | |
| α-helix | 177 | 1 | |
| β-strand | 178 | 1 | 2 |
| α-helix | 179 | 1 | |
| α-helix | 183-186 | 4 | |
| α-helix | 187-189 | 3 | |
| β-strand | 192 | 1 | 1 |
| β-strand | 193 | 1 | 3 |
| β-strand | 199-201 | 3 | 4 |
| β-strand | 205-207 | 3 | 4 |
| β-strand | 208-209 | 2 | 5 |
| α-helix | 210-212 | 3 | |
| α-helix | 213-222 | 10 | |
| β-strand | 226 | 1 | 3 |
| β-strand | 227 | 1 | 6 |
| β-strand | 235 | 1 | 4 |
| α-helix | 243-245 | 3 | |
| β-strand | 273-274 | 2 | 5 |
| β-strand | 283 | 1 | 6 |
| β-strand | 284-285 | 2 | 7 |
| β-strand | 290-291 | 2 | 7 |
| α-helix | 295-302 | 8 | |
Chain B: 13 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-16 | 11 | |
| α-helix | 22-31 | 10 | |
| α-helix | 32-35 | 4 | |
| α-helix | 47-57 | 11 | |
| α-helix | 63-75 | 13 | |
| α-helix | 93-115 | 23 | |
| β-strand | 125-127 | 3 | 8 |
| α-helix | 132-140 | 9 | |
| β-strand | 151-152 | 2 | 8 |
| α-helix | 162-169 | 8 | |
| β-strand | 177 | 1 | 8 |
| α-helix | 180-182 | 3 | |
| α-helix | 187-189 | 3 | |
| β-strand | 192-196 | 5 | 8 |
| β-strand | 199-200 | 2 | 9 |
| β-strand | 206-207 | 2 | 9 |
| β-strand | 209 | 1 | 10 |
| α-helix | 213-220 | 8 | |
| β-strand | 226-229 | 4 | 8 |
| β-strand | 235 | 1 | 9 |
| α-helix | 248-251 | 4 | |
| β-strand | 273 | 1 | 10 |
| β-strand | 284-285 | 2 | 11 |
| β-strand | 290-291 | 2 | 11 |
| α-helix | 296-300 | 5 | |
Chain C: 12 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-23 | 12 | |
| α-helix | 32-42 | 11 | |
| α-helix | 54-71 | 18 | |
| α-helix | 77-97 | 21 | |
| α-helix | 129-153 | 25 | |
| α-helix | 155-157 | 3 | |
| β-strand | 164-168 | 5 | 12 |
| α-helix | 172-184 | 13 | |
| β-strand | 188-192 | 5 | 12 |
| β-strand | 193 | 1 | 13 |
| α-helix | 201-206 | 6 | |
| β-strand | 214-216 | 3 | 12 |
| β-strand | 218 | 1 | 13 |
| α-helix | 222-227 | 6 | |
| β-strand | 232 | 1 | 12 |
| β-strand | 234-235 | 2 | 14 |
| β-strand | 236-239 | 4 | 15 |
| β-strand | 245-248 | 4 | 15 |
| α-helix | 251-257 | 7 | |
| β-strand | 266-268 | 3 | 14 |
| β-strand | 274 | 1 | 15 |
| β-strand | 306-308 | 3 | 16 |
| β-strand | 313-316 | 4 | 15 |
| β-strand | 323-327 | 5 | 14 |
| β-strand | 329-331 | 3 | 14 |
| α-helix | 337-343 | 7 | |
| α-helix | 346-349 | 4 | |
Chain D: 13 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-21 | 10 | |
| α-helix | 32-40 | 9 | |
| α-helix | 54-71 | 18 | |
| α-helix | 79-97 | 19 | |
| α-helix | 129-153 | 25 | |
| β-strand | 164-168 | 5 | 17 |
| α-helix | 172-184 | 13 | |
| β-strand | 188-192 | 5 | 17 |
| α-helix | 201-206 | 6 | |
| β-strand | 215-216 | 2 | 17 |
| α-helix | 219-221 | 3 | |
| β-strand | 232-235 | 4 | 17 |
| β-strand | 238-239 | 2 | 18 |
| β-strand | 245-246 | 2 | 18 |
| β-strand | 248 | 1 | 19 |
| α-helix | 251-258 | 8 | |
| β-strand | 265-268 | 4 | 17 |
| β-strand | 274 | 1 | 18 |
| β-strand | 288 | 1 | 20 |
| α-helix | 291-293 | 3 | |
| β-strand | 311 | 1 | 20 |
| β-strand | 313 | 1 | 19 |
| α-helix | 318-320 | 3 | |
| β-strand | 323-325 | 3 | 17 |
| α-helix | 337-342 | 6 | |
| α-helix | 346-348 | 3 | |
Chain E: 9 helices, 25 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 21 |
| α-helix | 37-42 | 6 | |
| β-strand | 51-52 | 2 | 21 |
| β-strand | 53 | 1 | 22 |
| α-helix | 63-65 | 3 | |
| β-strand | 77 | 1 | 22 |
| α-helix | 86-92 | 7 | |
| β-strand | 101-103 | 3 | 21 |
| α-helix | 120-122 | 3 | |
| β-strand | 128-129 | 2 | 21 |
| β-strand | 132 | 1 | 23 |
| β-strand | 157-160 | 4 | 24 |
| β-strand | 170-171 | 2 | 24 |
| α-helix | 173-175 | 3 | |
| β-strand | 181-182 | 2 | 25 |
| α-helix | 184-189 | 6 | |
| β-strand | 194-196 | 3 | 24 |
| β-strand | 201 | 1 | 23 |
| β-strand | 205-207 | 3 | 21 |
| α-helix | 209-216 | 8 | |
| α-helix | 226-228 | 3 | |
| β-strand | 263-264 | 2 | 21 |
| β-strand | 357-358 | 2 | 26 |
| β-strand | 364 | 1 | 27 |
| β-strand | 374-375 | 2 | 26 |
| β-strand | 380 | 1 | 28 |
| β-strand | 381 | 1 | 27 |
| β-strand | 391-392 | 2 | 26 |
| β-strand | 397 | 1 | 28 |
| β-strand | 407 | 1 | 29 |
| β-strand | 408-409 | 2 | 26 |
| β-strand | 414 | 1 | 28 |
| β-strand | 424 | 1 | 29 |
| α-helix | 441-443 | 3 | |
Chain F: 7 helices, 25 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-7 | 2 | 30 |
| α-helix | 38-40 | 3 | |
| β-strand | 52-53 | 2 | 30 |
| α-helix | 63-65 | 3 | |
| α-helix | 86-90 | 5 | |
| β-strand | 103-104 | 2 | 30 |
| α-helix | 117-119 | 3 | |
| β-strand | 129 | 1 | 31 |
| β-strand | 132-133 | 2 | 32 |
| β-strand | 157 | 1 | 33 |
| β-strand | 159-160 | 2 | 34 |
| β-strand | 167 | 1 | 34 |
| β-strand | 171 | 1 | 33 |
| β-strand | 181-183 | 3 | 35 |
| α-helix | 184-189 | 6 | |
| β-strand | 193-195 | 3 | 34 |
| β-strand | 200-201 | 2 | 32 |
| α-helix | 209-215 | 7 | |
| β-strand | 264 | 1 | 31 |
| β-strand | 357 | 1 | 36 |
| β-strand | 363-364 | 2 | 37 |
| β-strand | 374 | 1 | 36 |
| α-helix | 375-376 | 2 | |
| β-strand | 380-381 | 2 | 37 |
| β-strand | 391 | 1 | 36 |
| β-strand | 397-398 | 2 | 37 |
| β-strand | 402-404 | 3 | 38 |
| β-strand | 408 | 1 | 39 |
| β-strand | 416 | 1 | 40 |
| β-strand | 419-421 | 3 | 38 |
| β-strand | 425 | 1 | 39 |
| β-strand | 434 | 1 | 40 |
Chain G: 18 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 170-172 | 3 | |
| α-helix | 192-194 | 3 | |
| α-helix | 205-214 | 10 | |
| α-helix | 224-237 | 14 | |
| α-helix | 252-255 | 4 | |
| α-helix | 257-266 | 10 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-286 | 16 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-314 | 6 | |
| α-helix | 315-326 | 12 | |
| β-strand | 333-336 | 4 | 16 |
| α-helix | 342-350 | 9 | |
| β-strand | 358-362 | 5 | 16 |
| α-helix | 370-378 | 9 | |
| β-strand | 383-387 | 5 | 16 |
| α-helix | 388-393 | 6 | |
| β-strand | 400-403 | 4 | 16 |
| β-strand | 407 | 1 | 41 |
| β-strand | 408 | 1 | 42 |
| β-strand | 414-417 | 4 | 41 |
| α-helix | 418-420 | 3 | |
| α-helix | 422-426 | 5 | |
| β-strand | 434-437 | 4 | 16 |
| α-helix | 440-442 | 3 | |
| β-strand | 443 | 1 | 42 |
| β-strand | 483-484 | 2 | 12 |
| β-strand | 489-492 | 4 | 41 |
| β-strand | 499-501 | 3 | 16 |
| β-strand | 508 | 1 | 16 |
| α-helix | 513-516 | 4 | |
Chain H: 15 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 175-177 | 3 | |
| α-helix | 192-194 | 3 | |
| α-helix | 205-214 | 10 | |
| α-helix | 224-237 | 14 | |
| α-helix | 253-266 | 14 | |
| α-helix | 271-286 | 16 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-314 | 6 | |
| α-helix | 315-326 | 12 | |
| β-strand | 333-334 | 2 | 43 |
| α-helix | 342-350 | 9 | |
| β-strand | 358-360 | 3 | 43 |
| α-helix | 370-378 | 9 | |
| β-strand | 383-385 | 3 | 43 |
| α-helix | 388-390 | 3 | |
| β-strand | 400-401 | 2 | 43 |
| β-strand | 403 | 1 | 44 |
| β-strand | 407-408 | 2 | 45 |
| β-strand | 414-416 | 3 | 45 |
| α-helix | 422-428 | 7 | |
| β-strand | 436-437 | 2 | 44 |
| β-strand | 457 | 1 | 46 |
| β-strand | 487 | 1 | 46 |
| β-strand | 490-492 | 3 | 45 |
| β-strand | 499-502 | 4 | 44 |
| β-strand | 505-508 | 4 | 44 |
| α-helix | 509-511 | 3 | |
| α-helix | 513-517 | 5 | |
5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Translation initiation factor eIF-2B subunit alpha | A, B | protein | 305 | Homo sapiens | Q14232 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit beta | C, D | protein | 351 | Homo sapiens | P49770 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit gamma | E, F | protein | 452 | Homo sapiens | Q9NR50 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit delta | G, H | protein | 523 | Homo sapiens | Q9UI10 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit epsilon | I, J | protein | 721 | Homo sapiens | Q13144 |
| Eukaryotic translation initiation factor 2 subunit 1 | K | protein | 315 | Homo sapiens | P05198 |
| Eukaryotic translation initiation factor 2 subunit 2 | M | protein | 333 | Homo sapiens | P20042 |
| Eukaryotic translation initiation factor 2 subunit 3 | P | protein | 472 | Homo sapiens | P41091 |
Sequence of entity 1 (A, B), FASTA
>6K71_1 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
Sequence of entity 2 (C, D), FASTA
>6K71_2 Translation initiation factor eIF-2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
Sequence of entity 3 (E, F), FASTA
>6K71_3 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence of entity 4 (G, H), FASTA
>6K71_4 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Sequence of entity 5 (I, J), FASTA
>6K71_5 Translation initiation factor eIF-2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
Sequence of entity 6 (K), FASTA
>6K71_6 Eukaryotic translation initiation factor 2 subunit 1 (chains K)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Sequence of entity 7 (M), FASTA
>6K71_7 Eukaryotic translation initiation factor 2 subunit 2 (chains M)
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Sequence of entity 8 (P), FASTA
>6K71_8 Eukaryotic translation initiation factor 2 subunit 3 (chains P)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Primary citation
Structural basis for eIF2B inhibition in integrated stress response. Kashiwagi, K., Yokoyama, T., Nishimoto, M. et al. Science (2019) 364:495-499. DOI 10.1126/science.aaw4104 · PubMed
Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
- 7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
- 9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7F64 2.42 Å, eIF2B-SFSV NSs
- 9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
- 3ECS 2.65 Å, Crystal structure of human eIF2B alpha
- 7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
- 9HVE 2.7 Å, Native human eIF2-eIF2B complex
- 7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
Browse structure collections
About this viewer
MolViewer shows 6K71 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.