6K72: EIF2(aP) - eIF2B complex
eIF2(aP) - eIF2B complex. Determined by electron microscopy at 4.6 Å resolution. Released 10 Jul 2019.
- Method
- Electron microscopy
- Resolution
- 4.6 Å
- Organism
- Homo sapiens
- Chains
- 14
- Atoms
- 32,731
- Mol. weight
- 684.36 kDa
- Released
- 10 Jul 2019
Explore 6K72 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6K72 contains 149 α-helices and 244 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 17 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-14 | 8 | |
| α-helix | 22-33 | 12 | |
| α-helix | 43-49 | 7 | |
| α-helix | 50-57 | 8 | |
| α-helix | 64-74 | 11 | |
| α-helix | 95-115 | 21 | |
| α-helix | 119-120 | 2 | |
| β-strand | 125-127 | 3 | 1 |
| α-helix | 134-143 | 10 | |
| β-strand | 150-153 | 4 | 1 |
| α-helix | 161-168 | 8 | |
| α-helix | 169-171 | 3 | |
| β-strand | 176-178 | 3 | 1 |
| α-helix | 183-189 | 7 | |
| β-strand | 193-195 | 3 | 2 |
| β-strand | 199-200 | 2 | 3 |
| β-strand | 206-208 | 3 | 3 |
| α-helix | 213-221 | 9 | |
| α-helix | 224-225 | 2 | |
| β-strand | 226-229 | 4 | 2 |
| α-helix | 232-234 | 3 | |
| β-strand | 235 | 1 | 3 |
| α-helix | 243-245 | 3 | |
| α-helix | 248-250 | 3 | |
| β-strand | 274-275 | 2 | 3 |
| β-strand | 283-285 | 3 | 2 |
| β-strand | 291 | 1 | 2 |
| α-helix | 295-301 | 7 | |
Chain B: 14 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-15 | 9 | |
| α-helix | 22-32 | 11 | |
| α-helix | 43-45 | 3 | |
| α-helix | 46-50 | 5 | |
| α-helix | 51-56 | 6 | |
| α-helix | 64-76 | 13 | |
| α-helix | 95-115 | 21 | |
| α-helix | 120 | 1 | |
| β-strand | 125-127 | 3 | 4 |
| α-helix | 134-142 | 9 | |
| β-strand | 150-153 | 4 | 4 |
| α-helix | 161-170 | 10 | |
| β-strand | 175-178 | 4 | 4 |
| α-helix | 183-186 | 4 | |
| β-strand | 192-196 | 5 | 4 |
| β-strand | 199-200 | 2 | 5 |
| β-strand | 206-208 | 3 | 5 |
| α-helix | 212-222 | 11 | |
| β-strand | 226-229 | 4 | 4 |
| β-strand | 235 | 1 | 5 |
| α-helix | 248-250 | 3 | |
| β-strand | 274-275 | 2 | 5 |
| β-strand | 283-286 | 4 | 4 |
| β-strand | 289-291 | 3 | 4 |
| α-helix | 296-302 | 7 | |
Chain C: 14 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 31-45 | 15 | |
| α-helix | 54-71 | 18 | |
| α-helix | 77-97 | 21 | |
| α-helix | 129-144 | 16 | |
| α-helix | 147-153 | 7 | |
| β-strand | 164-168 | 5 | 6 |
| α-helix | 172-181 | 10 | |
| β-strand | 188-192 | 5 | 6 |
| α-helix | 200-207 | 8 | |
| α-helix | 208-210 | 3 | |
| β-strand | 214-217 | 4 | 6 |
| α-helix | 222-225 | 4 | |
| β-strand | 232-234 | 3 | 7 |
| β-strand | 238-239 | 2 | 8 |
| β-strand | 245-248 | 4 | 8 |
| α-helix | 251-259 | 9 | |
| β-strand | 265-267 | 3 | 7 |
| β-strand | 274 | 1 | 8 |
| β-strand | 288 | 1 | 9 |
| α-helix | 291-293 | 3 | |
| α-helix | 303-305 | 3 | |
| β-strand | 306-308 | 3 | 10 |
| β-strand | 311 | 1 | 9 |
| β-strand | 313-316 | 4 | 8 |
| β-strand | 323-324 | 2 | 7 |
| α-helix | 336-343 | 8 | |
Chain D: 13 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-22 | 14 | |
| α-helix | 31-44 | 14 | |
| α-helix | 55-71 | 17 | |
| α-helix | 77-94 | 18 | |
| α-helix | 129-145 | 17 | |
| α-helix | 147-155 | 9 | |
| β-strand | 165-168 | 4 | 11 |
| α-helix | 172-181 | 10 | |
| β-strand | 189-192 | 4 | 11 |
| α-helix | 200-206 | 7 | |
| β-strand | 215-217 | 3 | 11 |
| α-helix | 222-225 | 4 | |
| β-strand | 232-234 | 3 | 12 |
| β-strand | 238-240 | 3 | 13 |
| β-strand | 245-246 | 2 | 13 |
| β-strand | 248 | 1 | 14 |
| α-helix | 251-260 | 10 | |
| β-strand | 265-267 | 3 | 12 |
| β-strand | 274-275 | 2 | 13 |
| β-strand | 288 | 1 | 15 |
| α-helix | 291-293 | 3 | |
| α-helix | 301-303 | 3 | |
| β-strand | 311 | 1 | 15 |
| β-strand | 313 | 1 | 14 |
| β-strand | 316 | 1 | 13 |
| β-strand | 323-324 | 2 | 12 |
| α-helix | 337-341 | 5 | |
Chain E: 8 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4 | 1 | 16 |
| β-strand | 7 | 1 | 17 |
| β-strand | 30 | 1 | 18 |
| β-strand | 34 | 1 | 18 |
| α-helix | 37-44 | 8 | |
| β-strand | 53-54 | 2 | 19 |
| α-helix | 68-70 | 3 | |
| β-strand | 77-78 | 2 | 19 |
| α-helix | 88-93 | 6 | |
| β-strand | 101-103 | 3 | 16 |
| β-strand | 104 | 1 | 17 |
| α-helix | 115-123 | 9 | |
| β-strand | 156 | 1 | 20 |
| β-strand | 158-161 | 4 | 21 |
| β-strand | 167 | 1 | 21 |
| β-strand | 172 | 1 | 20 |
| β-strand | 181-182 | 2 | 22 |
| α-helix | 184-188 | 5 | |
| β-strand | 192-196 | 5 | 21 |
| β-strand | 205-207 | 3 | 16 |
| α-helix | 209-217 | 9 | |
| α-helix | 224-226 | 3 | |
| α-helix | 284-287 | 4 | |
| β-strand | 350 | 1 | 23 |
| β-strand | 364 | 1 | 24 |
| β-strand | 366 | 1 | 23 |
| β-strand | 381 | 1 | 24 |
| β-strand | 385 | 1 | 25 |
| β-strand | 392 | 1 | 26 |
| β-strand | 397-398 | 2 | 27 |
| β-strand | 402 | 1 | 25 |
| β-strand | 409 | 1 | 26 |
| β-strand | 414-415 | 2 | 27 |
| β-strand | 419 | 1 | 25 |
| β-strand | 421 | 1 | 28 |
| β-strand | 437 | 1 | 28 |
Chain F: 7 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-7 | 2 | 29 |
| α-helix | 39-44 | 6 | |
| β-strand | 53-54 | 2 | 30 |
| α-helix | 62-65 | 4 | |
| β-strand | 77-78 | 2 | 30 |
| α-helix | 87-93 | 7 | |
| β-strand | 101-104 | 4 | 29 |
| α-helix | 115-123 | 9 | |
| β-strand | 132-133 | 2 | 31 |
| β-strand | 157-160 | 4 | 32 |
| β-strand | 167-171 | 5 | 32 |
| β-strand | 181-182 | 2 | 33 |
| α-helix | 184-189 | 6 | |
| β-strand | 192-196 | 5 | 32 |
| β-strand | 200-201 | 2 | 31 |
| β-strand | 205-207 | 3 | 29 |
| α-helix | 209-217 | 9 | |
| α-helix | 284-287 | 4 | |
| β-strand | 352 | 1 | 34 |
| β-strand | 369 | 1 | 34 |
| β-strand | 374 | 1 | 35 |
| β-strand | 381 | 1 | 36 |
| β-strand | 385 | 1 | 37 |
| β-strand | 391-392 | 2 | 35 |
| β-strand | 396-397 | 2 | 38 |
| β-strand | 398 | 1 | 36 |
| β-strand | 402 | 1 | 37 |
| β-strand | 408-409 | 2 | 35 |
| β-strand | 413-414 | 2 | 38 |
| β-strand | 419-420 | 2 | 39 |
| β-strand | 435-436 | 2 | 39 |
Chain G: 17 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 178-180 | 3 | |
| α-helix | 205-213 | 9 | |
| α-helix | 222-239 | 18 | |
| α-helix | 241-243 | 3 | |
| α-helix | 248-266 | 19 | |
| α-helix | 271-284 | 14 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-314 | 6 | |
| α-helix | 315-323 | 9 | |
| α-helix | 324-326 | 3 | |
| β-strand | 329-335 | 7 | 10 |
| α-helix | 341-350 | 10 | |
| β-strand | 355-362 | 8 | 10 |
| α-helix | 370-379 | 10 | |
| β-strand | 383-387 | 5 | 10 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 400-401 | 2 | 10 |
| β-strand | 407-408 | 2 | 40 |
| β-strand | 414-415 | 2 | 40 |
| β-strand | 416-417 | 2 | 41 |
| α-helix | 420-428 | 9 | |
| β-strand | 434 | 1 | 10 |
| β-strand | 435-437 | 3 | 42 |
| β-strand | 443 | 1 | 40 |
| α-helix | 460-462 | 3 | |
| β-strand | 482-484 | 3 | 6 |
| β-strand | 489-490 | 2 | 41 |
| β-strand | 499-502 | 4 | 42 |
| β-strand | 505-508 | 4 | 42 |
| α-helix | 509-517 | 9 | |
Chain H: 12 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 205-216 | 12 | |
| α-helix | 222-239 | 18 | |
| α-helix | 249-266 | 18 | |
| α-helix | 272-286 | 15 | |
| α-helix | 293-309 | 17 | |
| α-helix | 310-314 | 5 | |
| α-helix | 315-323 | 9 | |
| β-strand | 333-335 | 3 | 43 |
| α-helix | 340-350 | 11 | |
| β-strand | 358-362 | 5 | 43 |
| α-helix | 370-378 | 9 | |
| β-strand | 385-387 | 3 | 43 |
| α-helix | 388-390 | 3 | |
| β-strand | 401-402 | 2 | 43 |
| β-strand | 407-409 | 3 | 44 |
| β-strand | 413-415 | 3 | 44 |
| β-strand | 416 | 1 | 45 |
| α-helix | 420-428 | 9 | |
| β-strand | 434-435 | 2 | 43 |
| β-strand | 436-437 | 2 | 46 |
| β-strand | 443 | 1 | 44 |
| β-strand | 457 | 1 | 47 |
| β-strand | 483-485 | 3 | 11 |
| β-strand | 487 | 1 | 47 |
| β-strand | 490 | 1 | 45 |
| β-strand | 499-502 | 4 | 46 |
| β-strand | 505-508 | 4 | 46 |
| α-helix | 512-517 | 6 | |
6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Translation initiation factor eIF-2B subunit alpha | A, B | protein | 305 | Homo sapiens | Q14232 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit beta | C, D | protein | 351 | Homo sapiens | P49770 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit gamma | E, F | protein | 452 | Homo sapiens | Q9NR50 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit delta | G, H | protein | 523 | Homo sapiens | Q9UI10 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit epsilon | I, J | protein | 721 | Homo sapiens | Q13144 |
| Eukaryotic translation initiation factor 2 subunit 1 | K, L | protein | 315 | Homo sapiens | P05198 |
| Eukaryotic translation initiation factor 2 subunit 2 | M | protein | 333 | Homo sapiens | P20042 |
| Eukaryotic translation initiation factor 2 subunit 3 | P | protein | 472 | Homo sapiens | P41091 |
Sequence of entity 1 (A, B), FASTA
>6K72_1 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
Sequence of entity 2 (C, D), FASTA
>6K72_2 Translation initiation factor eIF-2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
Sequence of entity 3 (E, F), FASTA
>6K72_3 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence of entity 4 (G, H), FASTA
>6K72_4 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Sequence of entity 5 (I, J), FASTA
>6K72_5 Translation initiation factor eIF-2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
Sequence of entity 6 (K, L), FASTA
>6K72_6 Eukaryotic translation initiation factor 2 subunit 1 (chains K, L)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Sequence of entity 7 (M), FASTA
>6K72_7 Eukaryotic translation initiation factor 2 subunit 2 (chains M)
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Sequence of entity 8 (P), FASTA
>6K72_8 Eukaryotic translation initiation factor 2 subunit 3 (chains P)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Primary citation
Structural basis for eIF2B inhibition in integrated stress response. Kashiwagi, K., Yokoyama, T., Nishimoto, M. et al. Science (2019) 364:495-499. DOI 10.1126/science.aaw4104 · PubMed
Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
- 7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
- 9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7F64 2.42 Å, eIF2B-SFSV NSs
- 9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
- 3ECS 2.65 Å, Crystal structure of human eIF2B alpha
- 7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
- 9HVE 2.7 Å, Native human eIF2-eIF2B complex
- 7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
Browse structure collections
About this viewer
MolViewer shows 6K72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.