6KAG: SMARCB1/SMARCC2 subcomplex

Crystal structure of the SMARCB1/SMARCC2 subcomplex. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,977
Mol. weight: 69.3 kDa
Released: 23 Sept 2020

Explore 6KAG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KAG contains 18 α-helices and 8 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	186-195	10	1
β-strand	198-207	10	1
α-helix	215-226	12
α-helix	230-247	18
β-strand	263-270	8	2
β-strand	273-280	8	2
α-helix	290-301	12
α-helix	307-322	16
α-helix	333-336	4
β-strand	340	1	3
α-helix	341-342	2
β-strand	352-355	4	2

Chain B: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	428-430	3
α-helix	440-445	6
α-helix	447-449	3
α-helix	459-475	17
α-helix	483-487	5
β-strand	493	1	1
α-helix	494-507	14

Chain C: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	428-430	3
α-helix	440-445	6
α-helix	447-449	3
α-helix	459-475	17
α-helix	483-489	7
β-strand	490	1	3
α-helix	494-506	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	A	protein	217	Homo sapiens	Q12824 (AlphaFold model)
SWI/SNF complex subunit SMARCC2	B, C	protein	194	Homo sapiens	Q8TAQ2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KAG_1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (chains A)
DDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDL
NPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKEN
SPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQ
WCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW

Sequence of entity 2 (B, C), FASTA

>6KAG_2 SWI/SNF complex subunit SMARCC2 (chains B, C)
TKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQE
DESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERR
ALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFL
EQWGLINYQVDAES

Primary citation

A heterotrimeric SMARCB1-SMARCC2 subcomplex is required for the assembly and tumor suppression function of the BAF chromatin-remodeling complex. Chen, G., Zhou, H., Liu, B. et al. Cell Discov (2020) 6:66-66. DOI 10.1038/s41421-020-00196-4 · PubMed

Other PDB entries of the same protein (UniProt Q12824 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
5L7A 2.1 Å, The crystal structure of the Human SNF5/INI1 domain
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
6LTH 3.0 Å, Structure of human BAF Base module
7VDV 3.4 Å, The overall structure of human chromatin remodeling PBAF-nucleosome complex
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
6LTJ 3.7 Å, Structure of nucleosome-bound human BAF complex
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
7Y8R 4.4 Å, The nucleosome-bound human PBAF complex
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…
5AJ1 Solution Structure of the Smarc Domain

Browse structure collections

About this viewer

MolViewer shows 6KAG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.