Crystal structure of human NRMT1 in complex with alpha-N-monomethylated human CENP-A peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Jul 2020.
Explore 6KDQ in 3D Show helices and sheets RCSB PDB PDBe
6KDQ contains 35 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| α-helix | 9-21 | 13 | |
| α-helix | 27-30 | 4 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-54 | 17 | |
| α-helix | 59-61 | 3 | |
| β-strand | 64-68 | 5 | 1 |
| α-helix | 74-75 | 2 | |
| α-helix | 76-80 | 5 | |
| β-strand | 86-91 | 6 | 1 |
| α-helix | 94-103 | 10 | |
| α-helix | 105-110 | 6 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 119-121 | 3 | |
| α-helix | 124-125 | 2 | |
| β-strand | 129-135 | 7 | 1 |
| α-helix | 138-140 | 3 | |
| α-helix | 143-156 | 14 | |
| β-strand | 157-170 | 14 | 1 |
| β-strand | 174-177 | 4 | 1 |
| β-strand | 182-186 | 5 | 1 |
| α-helix | 187-196 | 10 | |
| β-strand | 201-206 | 6 | 1 |
| α-helix | 207-208 | 2 | |
| β-strand | 214 | 1 | 2 |
| α-helix | 215 | 1 | |
| β-strand | 216-222 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| α-helix | 9-21 | 13 | |
| α-helix | 27-30 | 4 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-53 | 16 | |
| α-helix | 59-61 | 3 | |
| β-strand | 64-68 | 5 | 3 |
| α-helix | 74-75 | 2 | |
| α-helix | 76-80 | 5 | |
| β-strand | 86-91 | 6 | 3 |
| α-helix | 94-103 | 10 | |
| α-helix | 107-110 | 4 | |
| β-strand | 111-116 | 6 | 3 |
| α-helix | 119-121 | 3 | |
| α-helix | 124-125 | 2 | |
| β-strand | 129-135 | 7 | 3 |
| α-helix | 138-140 | 3 | |
| α-helix | 143-154 | 12 | |
| β-strand | 157-170 | 14 | 3 |
| β-strand | 174-177 | 4 | 3 |
| β-strand | 182-186 | 5 | 3 |
| α-helix | 187-196 | 10 | |
| β-strand | 201-206 | 6 | 3 |
| α-helix | 207-208 | 2 | |
| β-strand | 214 | 1 | 4 |
| α-helix | 215 | 1 | |
| β-strand | 216-222 | 7 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 4 |
| α-helix | 5-6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| N-terminal Xaa-Pro-Lys N-methyltransferase 1 | A, B | protein | 243 | Homo sapiens | Q9BV86 (AlphaFold model) |
| CENP-A peptide | E, F | protein | 7 | Homo sapiens | P49450 (AlphaFold model) |
>6KDQ_1 N-terminal Xaa-Pro-Lys N-methyltransferase 1 (chains A, B) MGSSHHHHHHSSGLVPRGSHMTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSI DINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQA KTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPN GIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSF ALR
>6KDQ_2 CENP-A peptide (chains E, F) GPRRRSR
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 2 |
Substrate engagement regulates state-specific alpha-N methylation of CENP-A by NRMT2. Wu, R., Yue, Y., Zheng, X. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BV86 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.