6KLU: Troponin C, slow skeletal and cardiac muscles

Troponin of cardiac thin filament in high-calcium state. Determined by electron microscopy at 12.0 Å resolution. Released 15 Jan 2020.

Method: Electron microscopy
Resolution: 12.0 Å
Organism: Mus musculus
Chains: 3
Atoms: 2,712
Mol. weight: 41.05 kDa
Ligands: CA
Released: 15 Jan 2020

Explore 6KLU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KLU contains 20 α-helices and 4 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	14-28	15
β-strand	36	1	1
α-helix	38-47	10
α-helix	54-62	9
β-strand	72	1	1
α-helix	74-84	11
α-helix	94-104	11
β-strand	111-112	2	2
α-helix	114-123	10
α-helix	130-140	11
β-strand	148-149	2	2
α-helix	150-157	8

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	200-215	16
α-helix	216-218	3
α-helix	226-245	20
α-helix	251-257	7
α-helix	259-270	12

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	50-61	12
α-helix	65-76	12
α-helix	81-83	3
α-helix	90-136	47
α-helix	151-159	9
α-helix	160-162	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C, slow skeletal and cardiac muscles	A	protein	157	Mus musculus	P19123 (AlphaFold model)
Troponin T, cardiac muscle	B	protein	74	Mus musculus	P50752 (AlphaFold model)
Troponin I, cardiac muscle	C	protein	118	Mus musculus	P48787 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KLU_1 Troponin C, slow skeletal and cardiac muscles (chains A)
DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI
DEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMML
QATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMK

Sequence of entity 2 (B), FASTA

>6KLU_2 Troponin T, cardiac muscle (chains B)
GKRQTEREKKKKILAERRKALAIDHLNEDQLREKAKELWQSIHNLEAEKFDLQEKFKQQK
YEINVLRNRINDNQ

Sequence of entity 3 (C), FASTA

>6KLU_3 Troponin I, cardiac muscle (chains C)
LKTLMLQIAKQEMEREAEERRGEKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVD
EERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKES

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Cryo-EM structures of cardiac thin filaments reveal the 3D architecture of troponin. Oda, T., Yanagisawa, H., Wakabayashi, T. J Struct Biol (2020) 209:107450-107450. DOI 10.1016/j.jsb.2020.107450 · PubMed

Other PDB entries of the same protein (UniProt P19123 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MOW 4.9 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…
9MOP 5.0 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…
9MOM 5.1 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially…
9MO7 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound fully…
9MO8 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-free state (upper…
9MOL 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-free tilted state…
9MON 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound fully…
9MOO 5.2 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…
9MOX 5.2 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…
9MO4 5.3 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-free state (lower…
9MO5 5.3 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially…
9MO6 5.3 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-free tilted state…

Browse structure collections

About this viewer

MolViewer shows 6KLU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.