6KN5: AFF4 C-terminal domain

Name: PDB 6KN5: Crystal structure of AFF4 C-terminal domain
Published: 2020-07-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of AFF4 C-terminal domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 8 Jul 2020.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,869
Mol. weight: 29.77 kDa
Released: 8 Jul 2020

Explore 6KN5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KN5 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	905-908	4
α-helix	915-931	17
α-helix	935-958	24
α-helix	967-981	15
α-helix	993-1017	25
α-helix	1019-1032	14
α-helix	1087-1116	30
α-helix	1117-1120	4
α-helix	1121-1131	11
α-helix	1141-1159	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AF4/FMR2 family member 4	A	protein	266	Homo sapiens	Q9UHB7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KN5_1 AF4/FMR2 family member 4 (chains A)
GSKPRRTKLVFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALE
KNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLK
KENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSAS
ASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFN
ASIMTDLVRYTRQGLHWLRQDAKLIS

Primary citation

Acetylation of histone H3K27 signals the transcriptional elongation for estrogen receptor alpha. Gao, Y., Chen, L., Han, Y. et al. Commun Biol (2020) 3:165-165. DOI 10.1038/s42003-020-0898-0 · PubMed

Other PDB entries of the same protein (UniProt Q9UHB7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JW9 2.0 Å, The Crystal Structure of ELL2 Oclludin Domain and AFF4 peptide
6R80 2.2 Å, Structure of AFF4 C-terminal homology domain
6K7P 2.4 Å, Crystal structure of human AFF4-THD domain
4OR5 2.9 Å, Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4
4IMY 2.94 Å, The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
4OGR 3.0 Å, crystal structure of P-TEFb complex with AFF4 and Tat
6CYT 3.5 Å, HIV-1 TAR loop in complex with Tat:AFF4:P-TEFb
5L1Z 5.9 Å, TAR complex with HIV-1 Tat-AFF4-P-TEFb

Browse structure collections

About this viewer

MolViewer shows 6KN5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.