6KU9: B646L

Structure of the African swine fever virus major capsid protein p72. Determined by electron microscopy at 2.67 Å resolution. Released 25 Sept 2019.

Method: Electron microscopy
Resolution: 2.67 Å
Organism: African swine fever virus
Chains: 3
Atoms: 11,739
Mol. weight: 236.79 kDa
Released: 25 Sept 2019

Explore 6KU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KU9 contains 48 α-helices and 125 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 16 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	72-77	6	1
β-strand	89-93	5	2
β-strand	100-110	11	1
α-helix	111-112	2
β-strand	113	1	3
β-strand	117-118	2	4
α-helix	119-122	4
β-strand	128	1	5
β-strand	134	1	5
α-helix	138-139	2
β-strand	142	1	6
β-strand	149	1	6
β-strand	153-158	6	7
β-strand	164	1	7
β-strand	173-174	2	4
β-strand	176-179	4	8
α-helix	180	1
α-helix	183-187	5
β-strand	188-195	8	2
β-strand	199-204	6	2
α-helix	205-215	11
α-helix	221-228	8
β-strand	234-241	8	9
β-strand	245-246	2	9
β-strand	307-314	8	9
β-strand	321	1	8
β-strand	324	1	3
α-helix	325-326	2
β-strand	327-332	6	1
α-helix	344	1
β-strand	345-346	2	1
β-strand	355-361	7	2
α-helix	362-363	2
β-strand	368-371	4	8
β-strand	375-382	8	7
β-strand	387-395	9	7
α-helix	402-406	5
β-strand	407-417	11	1
β-strand	436	1	10
β-strand	439-446	8	11
β-strand	451-455	5	12
β-strand	463-472	10	11
α-helix	473-476	4
α-helix	483-486	4
β-strand	492-498	7	9
β-strand	501-506	6	7
β-strand	518-523	6	7
β-strand	528-534	7	9
β-strand	537-543	7	12
β-strand	553-554	2	12
α-helix	555-556	2
α-helix	557-561	5
α-helix	562-565	4
β-strand	579-583	5	11
β-strand	607-612	6	12
β-strand	621-629	9	11
β-strand	631	1	10

Chain B: 16 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	72-77	6	13
β-strand	89-93	5	14
β-strand	100-110	11	13
α-helix	111-112	2
β-strand	113	1	15
β-strand	117-118	2	16
α-helix	119-122	4
β-strand	125	1	17
β-strand	128	1	18
β-strand	134	1	18
β-strand	137	1	17
α-helix	138-139	2
β-strand	142	1	19
β-strand	149	1	19
β-strand	153-158	6	20
β-strand	164	1	20
β-strand	173-174	2	16
β-strand	176-179	4	21
α-helix	180	1
α-helix	183-187	5
β-strand	188-195	8	14
β-strand	199-204	6	14
α-helix	205-215	11
α-helix	221-228	8
β-strand	234-241	8	9
β-strand	245-246	2	9
β-strand	307-314	8	9
β-strand	321	1	21
β-strand	324	1	15
α-helix	325-326	2
β-strand	327-332	6	13
α-helix	344	1
β-strand	345-346	2	13
β-strand	355-361	7	14
α-helix	362-363	2
β-strand	368-371	4	21
β-strand	375-382	8	20
β-strand	387-395	9	20
α-helix	402-406	5
β-strand	407-417	11	13
β-strand	436	1	22
β-strand	439-446	8	23
β-strand	451-455	5	24
β-strand	463-472	10	23
α-helix	473-476	4
α-helix	483-486	4
β-strand	492-498	7	9
β-strand	501-506	6	20
β-strand	518-523	6	20
β-strand	528-534	7	9
β-strand	537-543	7	24
β-strand	553-554	2	24
α-helix	555-556	2
α-helix	557-561	5
α-helix	562-565	4
β-strand	579-583	5	23
β-strand	607-612	6	24
β-strand	621-629	9	23
β-strand	631	1	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B646L	A, B, C	protein	693	African swine fever virus	P22776 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6KU9_1 B646L (chains A, B, C)
MHHHHHHHHHHGSDYKDHDGDYKDHDIDYKDDDDKELENLYFQGAGSMASGGAFCLIAND
GKADKIILAQDLLNSRISNIKNVNKSYGKPDPEPTLSQIEETHLVHFNAHFKPYVPVGFE
YNKVRPHTGTPTLGNKLTFGIPQYGDFFHDMVGHHILGACHSSWQDAPIQGTSQMGAHGQ
LQTFPRNGYDWDNQTPLEGAVYTLVDPFGRPIVPGTKNAYRNLVYYCEYPGERLYENVRF
DVNGNSLDEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGPLLCNIHDLHKPHQ
SKPILTDENDTQRTCSHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYS
CNGPQTPKYYQPPLALWIKLRFWFNENVNLAIPSVSIPFGERFITIKLASQKDLVNEFPG
LFVRQSRFIAGRPSRRNIRFKPWFIPGVINEISLTNNELYINNLFVTPEIHNLFVKRVRF
SLIRVHKTQVTHTNNNHHDEKLMSALKWPIEYMFIGLKPTWNISDQNPHQHRDWHKFGHV
VNAIMQPTHHAEISFQDRDTALPDACSSISDISPVTYPITLPIIKNISVTAHGINLIDKF
PSKFCSSYIPFHYGGNAIKTPDDPGAMMITFALKPREEYQPSGHINVSRAREFYISWDTD
YVGSITTADLVVSASAINFLLLQNGSAVLRYST

Primary citation

Structure of the African swine fever virus major capsid protein p72. Liu, Q., Ma, B., Qian, N. et al. Cell Res (2019) 29:953-955. DOI 10.1038/s41422-019-0232-x · PubMed

Other PDB entries of the same protein (UniProt P22776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EMD 1.7 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…
8Y3O 2.75 Å, ASFV p72 in complex with Fab B1
8Y3Q 2.98 Å, ASFV p72 in complex with Fab F11
8Y3P 3.48 Å, ASFV p72 in complex with Fab C9
8Y3R 3.48 Å, ASFV p72 in complex with Fab H3
6L2T 4.1 Å, African swine fever virus major capsid protein p72
8ZL9 4.36 Å, ASFV p72 in complex with Fab G6

Browse structure collections

About this viewer

MolViewer shows 6KU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.