8ZL9: ASFV p72

ASFV p72 in complex with Fab G6. Determined by electron microscopy at 4.36 Å resolution. Released 18 Sept 2024.

Method: Electron microscopy
Resolution: 4.36 Å
Organisms: Sus scrofa, African swine fever virus
Chains: 5
Atoms: 6,644
Mol. weight: 262.43 kDa
Released: 18 Sept 2024

Explore 8ZL9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZL9 contains 14 α-helices and 100 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	19	1	2
β-strand	21-23	3	1
β-strand	38-39	2	3
β-strand	45-46	2	3
β-strand	49	1	4
β-strand	60	1	4
β-strand	68-71	4	2
β-strand	78	1	1
β-strand	80-83	4	2
β-strand	93-94	2	5
β-strand	101	1	6
β-strand	106	1	6
β-strand	116-117	2	5

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	38-41	4	8
β-strand	49-53	5	8
β-strand	57-58	2	8
β-strand	66	1	7
β-strand	69-71	3	7
β-strand	74-79	6	7
α-helix	84-86	3
β-strand	88-93	6	8
β-strand	106-110	5	8

Chain C: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	115-117	3
β-strand	118	1	9
β-strand	126-128	3	10
α-helix	130-132	3
β-strand	134-136	3	10
β-strand	142	1	11
β-strand	149	1	11
β-strand	154	1	12
β-strand	157-158	2	12
β-strand	164	1	12
β-strand	173	1	9
β-strand	237	1	13
β-strand	241-244	4	14
β-strand	304-307	4	14
β-strand	308	1	15
β-strand	310	1	13
β-strand	313-314	2	16
β-strand	375-379	5	12
β-strand	391-394	4	12
β-strand	506	1	17
β-strand	518	1	17

Chain D: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	115	1	18
β-strand	119	1	19
α-helix	120-122	3
β-strand	128	1	20
α-helix	130-132	3
β-strand	134	1	20
β-strand	142	1	21
β-strand	149	1	21
β-strand	154-158	5	22
β-strand	164	1	22
β-strand	170	1	19
β-strand	177	1	23
β-strand	179	1	24
α-helix	232-235	4
β-strand	237	1	25
β-strand	241-242	2	26
β-strand	306-307	2	26
β-strand	308-310	3	27
β-strand	314	1	15
β-strand	321	1	23
α-helix	324-326	3
β-strand	368	1	24
β-strand	375-379	5	22
β-strand	380-382	3	28
β-strand	387	1	29
β-strand	388-391	4	28
β-strand	393-395	3	22
β-strand	402	1	18
β-strand	496	1	30
β-strand	497-498	2	13
β-strand	518	1	29
β-strand	521-522	2	28
β-strand	528-529	2	13

Chain E: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	110	1	31
β-strand	113	1	32
β-strand	119	1	33
α-helix	120-122	3
β-strand	125-128	4	34
α-helix	130-132	3
β-strand	134-137	4	34
α-helix	138-139	2
β-strand	142	1	35
β-strand	149	1	35
β-strand	158	1	36
β-strand	170	1	33
β-strand	176	1	37
β-strand	177	1	38
α-helix	183-185	3
β-strand	234-235	2	27
β-strand	245	1	30
β-strand	308-309	2	16
β-strand	312-314	3	27
β-strand	321	1	38
β-strand	324	1	32
α-helix	325-326	2
β-strand	327	1	31
β-strand	371	1	37
β-strand	375-377	3	36
β-strand	391	1	39
β-strand	393-395	3	36
α-helix	483-486	4
β-strand	492-498	7	25
β-strand	501	1	40
β-strand	522	1	39
β-strand	523	1	40
β-strand	528-534	7	25
α-helix	535	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G6 Heavy chain	A	protein	122	Sus scrofa
G6 Light chain	B	protein	110	Sus scrofa
B646L	C, D, E	protein	693	African swine fever virus	P22776 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ZL9_1 G6 Heavy chain (chains A)
EVKLVESGGGLVQPGGSLTLSCVGSGYTFSSYPICWVRQAPGKGLEWLSCIDSSGSKMHL
ADSVLSRFTISKDNSQNTAYLQMNSLRTEDTARYYCARGRWCYGVICDMDLWGPGVEVVV
SS

Sequence of entity 2 (B), FASTA

>8ZL9_2 G6 Light chain (chains B)
IVLTQTPLSLSVSPGEPASISCRSSQSLEEYGKNWLSWYQQKPGQSPRLLIYQATNRASW
VPERFSGSGSGTDFTLKISRVEAEDAGVYYCQQYKEFPWTFGQGTKLELK

Sequence of entity 3 (C, D, E), FASTA

>8ZL9_3 B646L (chains C, D, E)
MHHHHHHHHHHGSDYKDHDGDYKDHDIDYKDDDDKELENLYFQGAGSMASGGAFCLIAND
GKADKIILAQDLLNSRISNIKNVNKSYGKPDPEPTLSQIEETHLVHFNAHFKPYVPVGFE
YNKVRPHTGTPTLGNKLTFGIPQYGDFFHDMVGHHILGACHSSWQDAPIQGTSQMGAHGQ
LQTFPRNGYDWDNQTPLEGAVYTLVDPFGRPIVPGTKNAYRNLVYYCEYPGERLYENVRF
DVNGNSLDEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGPLLCNIHDLHKPHQ
SKPILTDENDTQRTCSHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYS
CNGPQTPKYYQPPLALWIKLRFWFNENVNLAIPSVSIPFGERFITIKLASQKDLVNEFPG
LFVRQSRFIAGRPSRRNIRFKPWFIPGVINEISLTNNELYINNLFVTPEIHNLFVKRVRF
SLIRVHKTQVTHTNNNHHDEKLMSALKWPIEYMFIGLKPTWNISDQNPHQHRDWHKFGHV
VNAIMQPTHHAEISFQDRDTALPDACSSISDISPVTYPITLPIIKNISVTAHGINLIDKF
PSKFCSSYIPFHYGGNAIKTPDDPGAMMITFALKPREEYQPSGHINVSRAREFYISWDTD
YVGSITTADLVVSASAINFLLLQNGSAVLRYST

Primary citation

p72 antigenic mapping reveals a potential supersite of vulnerability for African swine fever virus. Yu, Q., Liang, D., Fu, W. et al. Cell Discov (2024) 10:80-80. DOI 10.1038/s41421-024-00692-x · PubMed

Other PDB entries of the same protein (UniProt P22776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EMD 1.7 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…
6KU9 2.67 Å, Structure of the African swine fever virus major capsid protein p72
8Y3O 2.75 Å, ASFV p72 in complex with Fab B1
8Y3Q 2.98 Å, ASFV p72 in complex with Fab F11
8Y3P 3.48 Å, ASFV p72 in complex with Fab C9
8Y3R 3.48 Å, ASFV p72 in complex with Fab H3
6L2T 4.1 Å, African swine fever virus major capsid protein p72

Browse structure collections

About this viewer

MolViewer shows 8ZL9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.