6L2T: B646L,Major capsid protein

African swine fever virus major capsid protein p72. Determined by electron microscopy at 4.1 Å resolution. Released 4 Mar 2020.

Method: Electron microscopy
Resolution: 4.1 Å
Organism: African swine fever virus
Chains: 3
Atoms: 13,604
Mol. weight: 219.66 kDa
Released: 4 Mar 2020

Explore 6L2T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L2T contains 41 α-helices and 141 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	23-39	17
β-strand	57	1	1
β-strand	67	1	2
α-helix	68-69	2
β-strand	71	1	3
β-strand	74	1	4
β-strand	93	1	5
β-strand	104-108	5	6
α-helix	110-112	3
β-strand	113	1	7
α-helix	116-117	2
β-strand	118	1	8
α-helix	139-141	3
β-strand	143	1	9
β-strand	149	1	9
α-helix	165-167	3
β-strand	173	1	8
β-strand	176	1	10
β-strand	177	1	11
α-helix	184-187	4
β-strand	190-195	6	5
β-strand	198-204	7	5
α-helix	209-212	4
α-helix	221-227	7
β-strand	233-234	2	12
β-strand	241-242	2	13
β-strand	246	1	14
α-helix	272-275	4
β-strand	306-307	2	13
β-strand	308-309	2	15
β-strand	313-314	2	12
β-strand	321	1	11
β-strand	324	1	7
β-strand	331-332	2	6
β-strand	355-360	6	5
β-strand	371	1	10
β-strand	376	1	16
β-strand	394	1	16
β-strand	410-414	5	6
β-strand	415	1	4
β-strand	418	1	3
α-helix	423-425	3
β-strand	433-441	9	17
β-strand	446	1	18
β-strand	452	1	19
β-strand	463	1	17
β-strand	471-472	2	18
α-helix	473-475	3
β-strand	494-495	2	20
β-strand	498	1	21
β-strand	528	1	21
β-strand	531-532	2	20
β-strand	539-540	2	22
β-strand	541	1	23
β-strand	542-544	3	22
β-strand	547-554	8	22
α-helix	555-556	2
α-helix	557-561	5
α-helix	562-565	4
β-strand	598	1	17
β-strand	609	1	23
β-strand	610	1	19
β-strand	621-622	2	18
β-strand	626-634	9	17

Chain B: 13 helices, 46 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	23-39	17
α-helix	52-54	3
β-strand	57	1	2
β-strand	67	1	24
α-helix	68-69	2
β-strand	70-71	2	25
β-strand	77	1	26
β-strand	104-110	7	26
β-strand	118	1	27
α-helix	139-141	3
β-strand	143	1	28
β-strand	149	1	28
β-strand	157-158	2	29
α-helix	165-167	3
β-strand	173	1	27
β-strand	176-179	4	30
α-helix	184-187	4
β-strand	188-195	8	31
β-strand	198-204	7	31
α-helix	205-209	5
α-helix	221-227	7
β-strand	232-234	3	32
β-strand	240-242	3	12
α-helix	272-275	4
β-strand	306-309	4	12
β-strand	313-315	3	32
β-strand	321	1	30
β-strand	327-328	2	26
β-strand	332	1	26
α-helix	351	1
β-strand	355-361	7	31
β-strand	368-371	4	30
β-strand	375-376	2	29
α-helix	377-378	2
β-strand	394	1	29
β-strand	407-414	8	26
β-strand	418-419	2	25
β-strand	434	1	33
β-strand	441	1	34
β-strand	455	1	35
β-strand	463	1	36
β-strand	467-472	6	34
β-strand	494	1	37
β-strand	495	1	14
β-strand	498	1	38
β-strand	504-505	2	39
β-strand	520-521	2	39
β-strand	528	1	38
β-strand	532	1	37
β-strand	541-544	4	35
β-strand	547-550	4	35
α-helix	562-565	4
β-strand	580	1	34
β-strand	598	1	36
β-strand	607-609	3	35
β-strand	621-626	6	34
β-strand	629	1	36
β-strand	633	1	33

Chain C: 12 helices, 46 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	23-38	16
α-helix	51-54	4
β-strand	57	1	24
β-strand	67	1	1
α-helix	68-69	2
β-strand	70-71	2	40
β-strand	104	1	41
β-strand	105	1	42
β-strand	109-110	2	43
β-strand	176-178	3	44
α-helix	184-187	4
β-strand	190-195	6	45
β-strand	198-204	7	45
α-helix	221-227	7
β-strand	232-234	3	15
β-strand	241-242	2	46
β-strand	246	1	20
α-helix	272-277	6
β-strand	306-307	2	46
β-strand	308-309	2	32
β-strand	313-315	3	15
β-strand	321	1	44
β-strand	327-328	2	43
β-strand	332	1	42
β-strand	356	1	45
β-strand	359-360	2	45
β-strand	369-371	3	44
β-strand	376	1	47
β-strand	394	1	47
β-strand	414	1	41
β-strand	418-419	2	40
α-helix	423-425	3
β-strand	434-436	3	48
β-strand	441	1	49
β-strand	444-446	3	50
β-strand	452	1	51
β-strand	455	1	52
β-strand	463-468	6	53
β-strand	471-472	2	50
α-helix	473-475	3
β-strand	492-494	3	54
β-strand	532-534	3	54
β-strand	540	1	55
β-strand	541-543	3	52
β-strand	548	1	52
β-strand	553	1	55
α-helix	555-556	2
α-helix	557-561	5
α-helix	562-565	4
β-strand	580-582	3	53
β-strand	598	1	53
β-strand	607-609	3	52
β-strand	610	1	51
β-strand	621-623	3	50
β-strand	626	1	49
β-strand	627-629	3	53
β-strand	631-633	3	48

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B646L,Major capsid protein	A, B, C	protein	646	African swine fever virus	P22776 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6L2T_1 B646L,Major capsid protein (chains A, B, C)
MASGGAFCLIANDGKADKIILAQDLLNSRISNIKNVNKSYGKPDPEPTLSQIEETHLVHF
NAHFKPYVPVGFEYNKVRPHTGTPTLGNKLTFGIPQYGDFFHDMVGHHILGACHSSWQDA
PIQGTSQMGAHGQLQTFPRNGYDWDNQTPLEGAVYTLVDPFGRPIVPGTKNAYRNLVYYC
EYPGLRLYENVRFEVNGNSLDEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGP
LLCNIHDLHKPHQSKPILTDENDTQRTCSHTNPKFLSQHFPHFPENIQTAGKQDITPITD
ATYLDIRRNVHYSCNGPQTPKYYQPPLALWIKLRFWFNDNVNLAIPSVSIPFGERFITIK
LASQKDLVNEFPGLFVRQSTVIAGRPSRRNIRFKPWFIPGVINEISLTNNELYINNLFVT
PEIHNLYVKRVRFSLIRVHKTQVTHTNNNHHDEKLMSALKWPIEYMFIGLKPTWNISDQN
PHQHRDWHKFGHVVNAIMQPTHHAEISFQDRDTALPDACSSISDISPVTYPITLPIIKNI
SVTAHGINLIDKFPSQFCSSYIPFHYGGNAIKTPDDPGAMMITFALYPREEYQPSGHINV
SRAREFYISWDSDYVGSITTADLVVSSSAINFLLLQNGSAVLRYST

Primary citation

Architecture of African swine fever virus and implications for viral assembly. Wang, N., Zhao, D., Wang, J. et al. Science (2019) 366:640-644. DOI 10.1126/science.aaz1439

Other PDB entries of the same protein (UniProt P22776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EMD 1.7 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…
6KU9 2.67 Å, Structure of the African swine fever virus major capsid protein p72
8Y3O 2.75 Å, ASFV p72 in complex with Fab B1
8Y3Q 2.98 Å, ASFV p72 in complex with Fab F11
8Y3P 3.48 Å, ASFV p72 in complex with Fab C9
8Y3R 3.48 Å, ASFV p72 in complex with Fab H3
8ZL9 4.36 Å, ASFV p72 in complex with Fab G6

Browse structure collections

About this viewer

MolViewer shows 6L2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.