6KUX: Alpha2A adrenergic receptor

Crystal structures of the alpha2A adrenergic receptor in complex with an antagonist RSC. Determined by X-ray diffraction at 2.7 Å resolution. Released 4 Dec 2019.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,979
Mol. weight: 45.86 kDa
Ligands: E3F, OLA, FLC
Released: 4 Dec 2019

Explore 6KUX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KUX contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	34-60	27
α-helix	67-69	3
α-helix	70-84	15
α-helix	87-95	9
α-helix	103-136	34
α-helix	138-143	6
α-helix	147-165	19
α-helix	197-201	5
α-helix	202-206	5
α-helix	207-1018	39
α-helix	1023-1041	19
α-helix	1056-1079	24
α-helix	1084-1102	19
α-helix	1103-1106	4
α-helix	368-396	29
α-helix	397-399	3
α-helix	405-416	12
α-helix	418-429	12
α-helix	431-442	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
alpha2A adrenergic receptor	A	protein	395	Homo sapiens	P08913 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KUX_1 alpha2A adrenergic receptor (chains A)
GGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASAD
ILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSAWHLCAISLDRYWSITQAI
EYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVIS
SCIGSFFAPCLIMILVYVRIYQIAKRRTADLEDNWETLNDNLKVIEKADNAAQVKDALTK
MRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAE
QLKTTRNAYIQKYLRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKF
FFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGD

Ligands and cofactors

ID	Name	Formula	Copies
E3F	(8~{a}~{R},12~{a}~{S},13~{a}~{S})-12-ethylsulfonyl-3-methoxy-5,6,8,8~{a},9,10,1…	C19 H28 N2 O3 S	1
OLA	Oleic acid	C18 H34 O2	1
FLC	Citrate anion	C6 H5 O7	1

Water and common crystallization additives (PEG) are not listed.

Primary citation

Crystal structures of the alpha2A adrenergic receptor in complex with an antagonist RSC. Qu, L., Zhou, Q.T., Wu, D. et al. To be published.

Other PDB entries of the same protein (UniProt P08913 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CBL 2.8 Å, Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with…
9PLN 2.8 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
9PLO 2.8 Å, Structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and…
7EJ8 3.0 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to brimonidine
6KUY 3.2 Å, Crystal structure of the alpha2A adrenergic receptor in complex with a partial agonist
7EJ0 3.2 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex
9CBM 3.2 Å, Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with…
9PQD 3.29 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
7EJK 3.4 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to oxymetazoline
7W7E 3.4 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a…
9IQR 3.4 Å, Cryo-EM structure of MT3-alpha2AAR
7W6P 3.47 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a G…

Browse structure collections

About this viewer

MolViewer shows 6KUX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.