9PLN: Alpha-2A adrenergic receptor

Locally-refined structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and N-(5-methylnaphthalen-1-yl)pyridin-4-amine (compound 4905). Determined by electron microscopy at 2.8 Å resolution. Released 20 Aug 2025.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,117
Mol. weight: 53.88 kDa
Ligands: A1CIU
Released: 20 Aug 2025

Explore 9PLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PLN contains 13 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	47-75	29
α-helix	84-96	13
α-helix	97-101	5
α-helix	102-110	9
α-helix	118-150	33
α-helix	153-158	6
α-helix	162-180	19
α-helix	209-216	8
α-helix	217-221	5
α-helix	222-241	20
α-helix	377-414	38
α-helix	423-443	21
α-helix	446-456	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2A adrenergic receptor	R	protein	491	Homo sapiens	P08913 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9PLN_1 Alpha-2A adrenergic receptor (chains R)
MKTIIALSYIFCLVFADYKDDDDASIDFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAP
GGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASAD
ILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAI
EYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVIS
SCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSA
GPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKG
KARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVV
IGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKK
ILCRGDRKRIV

Ligands and cofactors

ID	Name	Formula	Copies
A1CIU	N-(5-methylnaphthalen-1-yl)pyridin-4-amine	C16 H14 N2	1

Primary citation

Development of a random background to understand ligand optimization. Xu, X., Mailhot, O., Correy, G.J. et al. Nature (2026). DOI 10.1038/s41586-026-11013-5 · PubMed

Other PDB entries of the same protein (UniProt P08913 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KUX 2.7 Å, Crystal structures of the alpha2A adrenergic receptor in complex with an antagonist RSC.
9CBL 2.8 Å, Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with…
9PLO 2.8 Å, Structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and…
7EJ8 3.0 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to brimonidine
6KUY 3.2 Å, Crystal structure of the alpha2A adrenergic receptor in complex with a partial agonist
7EJ0 3.2 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex
9CBM 3.2 Å, Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with…
9PQD 3.29 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
7EJK 3.4 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to oxymetazoline
7W7E 3.4 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a…
9IQR 3.4 Å, Cryo-EM structure of MT3-alpha2AAR
7W6P 3.47 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a G…

Browse structure collections

About this viewer

MolViewer shows 9PLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.