6KUY: Alpha2A adrenergic receptor

Crystal structure of the alpha2A adrenergic receptor in complex with a partial agonist. Determined by X-ray diffraction at 3.2 Å resolution. Released 4 Dec 2019.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,786
Mol. weight: 44.84 kDa
Ligands: E39
Released: 4 Dec 2019

Explore 6KUY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KUY contains 22 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	36-47	12
α-helix	48-52	5
α-helix	53-59	7
α-helix	66-85	20
α-helix	87-94	8
α-helix	104-137	34
α-helix	139-144	6
α-helix	147-165	19
α-helix	194-201	8
α-helix	202-206	5
α-helix	207-1018	39
α-helix	1023-1041	19
α-helix	1044-1045	2
α-helix	1056-1080	25
α-helix	1084-1098	15
α-helix	1099-1103	5
α-helix	1104-1106	3
α-helix	366-367	2
α-helix	368-396	29
α-helix	407-416	10
α-helix	422-429	8
α-helix	431-442	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha2A adrenergic receptor	A	protein	395	Homo sapiens	P08913 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KUY_1 Alpha2A adrenergic receptor (chains A)
GGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASAD
ILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSAWHLCAISLDRYWSITQAI
EYNLKRTPRRIKAIILTVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVIS
SCIGSFFAPCLIMILVYVRIYQIAKRRTADLEDNWETLNDNLKVIEKADNAAQVKDALTK
MRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAE
QLKTTRNAYIQKYLRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKF
FFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGD

Ligands and cofactors

ID	Name	Formula	Copies
E39	(2~{S})-4-fluoranyl-2-(1~{H}-imidazol-5-yl)-1-propan-2-yl-2,3-dihydroindole	C14 H16 F N3	1

Water and common crystallization additives (PEG) are not listed.

Primary citation

Crystal structures of the alpha2A adrenergic receptor in complex with a partial agonist. Qu, L., Zhou, Q.T., Wu, D. et al. To be published.

Other PDB entries of the same protein (UniProt P08913 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KUX 2.7 Å, Crystal structures of the alpha2A adrenergic receptor in complex with an antagonist RSC.
9CBL 2.8 Å, Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with…
9PLN 2.8 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
9PLO 2.8 Å, Structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and…
7EJ8 3.0 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to brimonidine
7EJ0 3.2 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex
9CBM 3.2 Å, Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with…
9PQD 3.29 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
7EJK 3.4 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to oxymetazoline
7W7E 3.4 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a…
9IQR 3.4 Å, Cryo-EM structure of MT3-alpha2AAR
7W6P 3.47 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a G…

Browse structure collections

About this viewer

MolViewer shows 6KUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.