The solution structure of human Orc6. Determined by solution NMR. Released 9 Sept 2020.
Explore 6KVG in 3D Show helices and sheets RCSB PDB PDBe
6KVG contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-9 | 6 | |
| α-helix | 10-12 | 3 | |
| α-helix | 18-31 | 14 | |
| α-helix | 32-36 | 5 | |
| α-helix | 44-58 | 15 | |
| α-helix | 65-71 | 7 | |
| α-helix | 76-90 | 15 | |
| α-helix | 98-105 | 8 | |
| α-helix | 108-110 | 3 | |
| α-helix | 111-122 | 12 | |
| α-helix | 128-130 | 3 | |
| α-helix | 142-152 | 11 | |
| α-helix | 158-164 | 7 | |
| α-helix | 169-186 | 18 | |
| α-helix | 196-198 | 3 | |
| α-helix | 219-222 | 4 | |
| α-helix | 232-242 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Origin recognition complex subunit 6 | A | protein | 256 | Homo sapiens | Q9Y5N6 (AlphaFold model) |
>6KVG_1 Origin recognition complex subunit 6 (chains A) GPGSMGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAA SWMKCPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASK ILKSYESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLC KQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWK RKILENAASAQKATAE
Structural basis of DNA replication origin recognition by human Orc6 protein binding with DNA. Xu, N., You, Y., Liu, C. et al. Nucleic Acids Res (2020) 48:11146-11161. DOI 10.1093/nar/gkaa751 · PubMed
Other PDB entries of the same protein (UniProt Q9Y5N6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KVG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.