Crystal structure of mouse Cryptochrome 1 in complex with TH301 compound. Determined by X-ray diffraction at 2.1 Å resolution. Released 1 Apr 2020.
Explore 6KX7 in 3D Show helices and sheets RCSB PDB PDBe
6KX7 contains 31 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 1 |
| α-helix | 19-25 | 7 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 39-41 | 3 | |
| α-helix | 49-68 | 20 | |
| β-strand | 73-77 | 5 | 1 |
| α-helix | 80-91 | 12 | |
| β-strand | 93-99 | 7 | 1 |
| α-helix | 104-119 | 16 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 135-141 | 7 | |
| α-helix | 150-158 | 9 | |
| α-helix | 161-163 | 3 | |
| α-helix | 172-175 | 4 | |
| β-strand | 179 | 1 | 1 |
| α-helix | 186-190 | 5 | |
| α-helix | 191-194 | 4 | |
| α-helix | 214-227 | 14 | |
| α-helix | 242-244 | 3 | |
| α-helix | 246-247 | 2 | |
| α-helix | 252-257 | 6 | |
| α-helix | 262-276 | 15 | |
| α-helix | 288-300 | 13 | |
| β-strand | 321 | 1 | 2 |
| α-helix | 324-331 | 8 | |
| α-helix | 338-350 | 13 | |
| α-helix | 355-363 | 9 | |
| α-helix | 364-368 | 5 | |
| β-strand | 372 | 1 | 2 |
| α-helix | 374-384 | 11 | |
| α-helix | 390-400 | 11 | |
| α-helix | 417-422 | 6 | |
| α-helix | 427-432 | 6 | |
| α-helix | 434-436 | 3 | |
| α-helix | 441-444 | 4 | |
| α-helix | 447-449 | 3 | |
| α-helix | 452-458 | 7 | |
| β-strand | 462 | 1 | 3 |
| β-strand | 466 | 1 | 3 |
| α-helix | 467-469 | 3 | |
| α-helix | 473-493 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A | protein | 498 | Mus musculus | P97784 (AlphaFold model) |
>6KX7_1 Cryptochrome-1 (chains A) GTMGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQC LEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLAT EAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKC MTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPR MNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYT AATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLAR HAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGF GRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASR LNIERMKQIYQQLSRYRG
| ID | Name | Formula | Copies |
|---|---|---|---|
| DYX | 1-(4-chlorophenyl)-N-[2-(4-methoxyphenyl)-5,5-bis(oxidanylidene)-4,6-dihydrothi… | C24 H24 Cl N3 O4 S | 1 |
Isoform-selective regulation of mammalian cryptochromes. Miller, S., Son, Y.L., Aikawa, Y. et al. Nat Chem Biol (2020) 16:676-685. DOI 10.1038/s41589-020-0505-1 · PubMed
Other PDB entries of the same protein (UniProt P97784 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KX7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.