6L9F: TEAD4

Crystal structure of TEAD4 in complex with a novel FAM181A peptide. Determined by X-ray diffraction at 2.56 Å resolution. Released 11 Dec 2019.

Method: X-ray diffraction
Resolution: 2.56 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 3,847
Mol. weight: 57.47 kDa
Released: 11 Dec 2019

Explore 6L9F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L9F contains 20 α-helices and 27 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	213	1	1
β-strand	218-229	12	1
β-strand	234-243	10	1
β-strand	257-259	3	2
α-helix	260-266	7
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	2
β-strand	305-315	11	1
β-strand	321-329	9	2
β-strand	332-341	10	2
β-strand	344-346	3	1
β-strand	349-358	10	1
α-helix	359-360	2
α-helix	361-372	12
α-helix	376-383	8
β-strand	386-394	9	2
β-strand	400-410	11	2
β-strand	418-425	8	2

Chain B: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	213	1	1
β-strand	218-231	14	1
β-strand	234-244	11	1
α-helix	246	1
α-helix	248	1
α-helix	253-255	3
β-strand	256-259	4	3
α-helix	260-262	3
α-helix	264-266	3
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	3
β-strand	305-315	11	1
β-strand	320-329	10	3
β-strand	332-342	11	3
β-strand	344-346	3	1
β-strand	349-353	5	1
β-strand	357-358	2	1
α-helix	359-360	2
α-helix	361-371	11
α-helix	376-384	9
β-strand	386-394	9	3
β-strand	400-410	11	3
α-helix	411-412	2
β-strand	418-425	8	3

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	192-194	3
α-helix	199-202	4

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	199-202	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional enhancer factor TEF-3	A, B	protein	222	Mus musculus	Q62296 (AlphaFold model)
Protein FAM181A	C, D	protein	20	Homo sapiens	Q8N9Y4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6L9F_1 Transcriptional enhancer factor TEF-3 (chains A, B)
STMGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYD
KFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCST
KVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLEN
FTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Sequence of entity 2 (C, D), FASTA

>6L9F_2 Protein FAM181A (chains C, D)
PGQVPMRKRQLPASFWEEPR

Primary citation

Crystal structure of TEAD4 in complex with a novel FAM181A peptide. Chen, M., Zhou, Z. To be published.

Other PDB entries of the same protein (UniProt Q62296 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SBA 1.3 Å, Crystal Structure of mTEAD with a VGL4 Tertiary Structure Mimetic
5XJD 2.22 Å, TEAD in complex with fragment
5Z2Q 2.74 Å, Vgll1-TEAD4 core complex
4LN0 2.9 Å, Crystal structure of the VGLL4-TEAD4 complex
5GN0 2.9 Å, Structure of TAZ-TEAD complex
3JUA 3.0 Å, Structural basis of YAP recognition by TEAD4 in the Hippo pathway

Browse structure collections

About this viewer

MolViewer shows 6L9F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.