Structure of CDK5R1-bound FEM1C. Determined by X-ray diffraction at 2.35 Å resolution. Released 21 Oct 2020.
Explore 6LDP in 3D Show helices and sheets RCSB PDB PDBe
6LDP contains 53 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-13 | 7 | |
| α-helix | 16-24 | 9 | |
| α-helix | 31-35 | 5 | |
| β-strand | 39 | 1 | 1 |
| β-strand | 42 | 1 | 1 |
| α-helix | 44-50 | 7 | |
| α-helix | 54-63 | 10 | |
| α-helix | 65-67 | 3 | |
| β-strand | 72-76 | 5 | 2 |
| β-strand | 79-84 | 6 | 2 |
| α-helix | 86-93 | 8 | |
| α-helix | 96-104 | 9 | |
| α-helix | 119-125 | 7 | |
| α-helix | 129-137 | 9 | |
| α-helix | 152-158 | 7 | |
| α-helix | 162-170 | 9 | |
| α-helix | 185-192 | 8 | |
| α-helix | 195-202 | 8 | |
| α-helix | 206-208 | 3 | |
| α-helix | 217-224 | 8 | |
| α-helix | 227-233 | 7 | |
| α-helix | 241-254 | 14 | |
| α-helix | 255-259 | 5 | |
| α-helix | 262-278 | 17 | |
| α-helix | 285-287 | 3 | |
| α-helix | 294-296 | 3 | |
| α-helix | 305-309 | 5 | |
| α-helix | 310-313 | 4 | |
| α-helix | 315-330 | 16 | |
| α-helix | 335-350 | 16 | |
| α-helix | 354-369 | 16 | |
| α-helix | 386-390 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-12 | 4 | |
| α-helix | 18-21 | 4 | |
| α-helix | 32-34 | 3 | |
| β-strand | 39 | 1 | 3 |
| β-strand | 42 | 1 | 3 |
| α-helix | 44-50 | 7 | |
| α-helix | 54-61 | 8 | |
| β-strand | 72-76 | 5 | 4 |
| β-strand | 79-84 | 6 | 4 |
| α-helix | 86-93 | 8 | |
| α-helix | 96-104 | 9 | |
| α-helix | 119-126 | 8 | |
| α-helix | 129-137 | 9 | |
| α-helix | 152-159 | 8 | |
| α-helix | 162-170 | 9 | |
| α-helix | 185-192 | 8 | |
| α-helix | 195-203 | 9 | |
| α-helix | 206-208 | 3 | |
| α-helix | 217-224 | 8 | |
| α-helix | 227-233 | 7 | |
| α-helix | 241-257 | 17 | |
| α-helix | 262-276 | 15 | |
| α-helix | 285-287 | 3 | |
| α-helix | 305-308 | 4 | |
| α-helix | 311-313 | 3 | |
| α-helix | 315-330 | 16 | |
| α-helix | 335-350 | 16 | |
| α-helix | 354-368 | 15 | |
| α-helix | 386-389 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein fem-1 homolog C,Peptide from Cyclin-dependent kinase 5 activator 1 | A, B | protein | 418 | Homo sapiens | Q15078 (AlphaFold model), Q96JP0 (AlphaFold model) |
>6LDP_1 Protein fem-1 homolog C,Peptide from Cyclin-dependent kinase 5 activator 1 (chains A, B) GHMDLKTAVFNAARDGKLRLLTKLLASKSKEEVSSLISEKTNGATPLLMAARYGHLDMVE FLLEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNST PLRAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRK SVKGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVDFLTHHAQ TSKTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRTNIISKPVPQTLIMAYDY AKEVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCI NLWKYALDMQQSNLDPLSPMTASSLLSFAELFGGGSGGGSGGGSGGGSKKRLLLGLDR
Molecular basis for arginine C-terminal degron recognition by Cul2 FEM1 E3 ligase. Chen, X., Liao, S., Makaros, Y. et al. Nat Chem Biol (2021) 17:254-262. DOI 10.1038/s41589-020-00704-3 · PubMed
Other PDB entries of the same protein (UniProt Q15078 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6LDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.