6LFH: Chemically synthesized human lysozyme

X-ray crystal structure of chemically synthesized human lysozyme. Determined by X-ray diffraction at 1.46 Å resolution. Released 8 Jul 2020.

Method: X-ray diffraction
Resolution: 1.46 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,325
Mol. weight: 14.98 kDa
Released: 8 Jul 2020

Explore 6LFH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LFH contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
α-helix	5-14	10
β-strand	20	1	2
β-strand	23	1	2
α-helix	25-36	12
β-strand	39	1	1
β-strand	43-46	4	3
β-strand	51-54	4	3
β-strand	59-60	2	3
β-strand	66	1	4
β-strand	80	1	4
α-helix	81-85	5
α-helix	90-100	11
α-helix	105-108	4
α-helix	110-115	6
α-helix	122-124	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysozyme C	X	protein	130	Homo sapiens	P61626 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>6LFH_1 Lysozyme C (chains X)
KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQIN
SRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRD
VRQYVQGCGV

Primary citation

Efficient Chemical Protein Synthesis using Fmoc-Masked N-Terminal Cysteine in Peptide Thioester Segments. Kar, A., Mannuthodikayil, J., Singh, S. et al. Angew Chem Int Ed Engl (2020) 59:14796-14801. DOI 10.1002/anie.202000491 · PubMed

Other PDB entries of the same protein (UniProt P61626 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NWD 1.04 Å, Structure of chemically synthesized human lysozyme at 1 Angstrom resolution
5LSH 1.06 Å, human lysozyme in complex with a tetrasaccharide fragment of the O-chain of LPS from…
1JSF 1.15 Å, Full-matrix least-squares refinement of human lysozyme
7AP7 1.15 Å, Structure of the W64R amyloidogenic variant of human lysozyme
7XF6 1.3 Å, Crystal Structure of Human Lysozyme
1IWT 1.4 Å, Crystal Structure Analysis of Human lysozyme at 113K.
1IWU 1.4 Å, Crystal Structure Analysis of Human lysozyme at 127K.
1IWV 1.4 Å, Crystal Structure Analysis of Human lysozyme at 147K.
1IWW 1.4 Å, Crystal Structure Analysis of Human lysozyme at 152K.
1IWX 1.4 Å, Crystal Structure Analysis of Human lysozyme at 161K.
1IWY 1.4 Å, Crystal Structure Analysis of Human lysozyme at 170K.
1JWR 1.4 Å, Crystal structure of human lysozyme at 100 K

Browse structure collections

About this viewer

MolViewer shows 6LFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.