6LFL: Class A GPCR

Crystal structure of a class A GPCR. Determined by X-ray diffraction at 3.2 Å resolution. Released 2 Sept 2020.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Pyrococcus abyssi (strain GE5 / Orsay)
Chains: 1
Atoms: 3,737
Mol. weight: 57.12 kDa
Ligands: EBX
Released: 2 Sept 2020

Explore 6LFL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LFL contains 22 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	48-75	28
α-helix	82-109	28
α-helix	116-148	33
α-helix	161-176	16
α-helix	180-183	4
β-strand	185-187	3	1
α-helix	193-194	2
β-strand	195-197	3	1
α-helix	206-216	11
α-helix	217-221	5
α-helix	222-240	19
α-helix	1016-1026	11
β-strand	1033-1037	5	2
β-strand	1041	1	3
α-helix	1048-1058	11
α-helix	1062-1066	5
β-strand	1067-1072	6	2
β-strand	1075	1	3
α-helix	1077-1089	13
β-strand	1093-1096	4	2
α-helix	1102-1111	10
β-strand	1114-1117	4	2
α-helix	1126-1133	8
β-strand	1137-1141	5	2
α-helix	1146-1149	4
β-strand	1156-1158	3	2
α-helix	1163-1176	14
α-helix	1182-1196	15
α-helix	247-278	32
α-helix	290-306	17
α-helix	309-316	8
α-helix	319-331	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C chemokine receptor type 2,GlgA glycogen synthase,C-X-C chemokine receptor type 2	A	protein	502	Homo sapiens, Pyrococcus abyssi (strain GE5 / Orsay)	P25025 (AlphaFold model), Q9V2J8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LFL_1 C-X-C chemokine receptor type 2,GlgA glycogen synthase,C-X-C chemokine receptor type 2 (chains A)
APCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLL
FALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGIWLLACISVDRYLAIVHATRTLT
QKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQ
SFGFIVPLLIMLFCYGFTLRTLFKAGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTF
MFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKV
ITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETG
ILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSGQKHREMRVIFAVVLIFLL
CWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILAILHSCLNPLIYAFIGQKFR
HGLLKILAIHGLISKDSLPKDS

Ligands and cofactors

ID	Name	Formula	Copies
EBX	4-[[3,4-bis(oxidanylidene)-2-[[(1~{R})-1-(4-propan-2-ylfuran-2-yl)propyl]amino]…	C22 H26 N4 O5	1

Primary citation

Structural basis of CXC chemokine receptor 2 activation and signalling. Liu, K., Wu, L., Yuan, S. et al. Nature (2020) 585:135-140. DOI 10.1038/s41586-020-2492-5 · PubMed

Other PDB entries of the same protein (UniProt P25025 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KVA 2.2 Å, Structure of anti-hCXCR2 abN48-2 in complex with its CXCR2 epitope
6KVF 2.79 Å, Structure of anti-hCXCR2 abN48 in complex with its CXCR2 epitope
8XXH 2.8 Å, Structure of CXCR2 bound to CXCL2 (CXCR2-CXCL2-Go Full map)
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWS 3.06 Å, Structure of CXCR2 bound to CXCL5 (Ligand-receptor focused map)
8XWV 3.07 Å, Structure of CXCR2 bound to CXCL1 (CXCR2-CXCL1-Go Full map)
8XVU 3.09 Å, Structure of CXCR2 bound to CXCL2 (Ligand-receptor focused map)
8XXR 3.17 Å, Structure of CXCR2 bound to CXCL6 (CXCR2-CXCL6-Go Full map)
8XXX 3.17 Å, Structure of CXCR2 bound to CXCL6 (Composite map)
8XWN 3.29 Å, Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map)
8XX7 3.32 Å, Structure of CXCR2 bound to CXCL5 (CXCR2-CXCL5-Go Full map)
8XX3 3.38 Å, Structure of CXCR2 bound to CXCL3 (CXCR2-CXCL3-Go Full map)

Browse structure collections

About this viewer

MolViewer shows 6LFL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.