Crystal structure of human Sirt5 in complex with the fluorogenic tetrapeptide substrate P15. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Oct 2020.
Explore 6LJN in 3D Show helices and sheets RCSB PDB PDBe
6LJN contains 17 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 37 | 1 | 1 |
| α-helix | 40-49 | 10 | |
| β-strand | 52-57 | 6 | 1 |
| α-helix | 59-63 | 5 | |
| β-strand | 77 | 1 | 2 |
| β-strand | 80 | 1 | 2 |
| α-helix | 82-85 | 4 | |
| α-helix | 88-93 | 6 | |
| α-helix | 95-108 | 14 | |
| α-helix | 109-111 | 3 | |
| α-helix | 116-130 | 15 | |
| β-strand | 134-139 | 6 | 1 |
| α-helix | 145-148 | 4 | |
| β-strand | 154-156 | 3 | 1 |
| β-strand | 159-166 | 8 | 3 |
| β-strand | 172-174 | 3 | 3 |
| α-helix | 182-184 | 3 | |
| α-helix | 194-196 | 3 | |
| α-helix | 201-203 | 3 | |
| β-strand | 206 | 1 | 4 |
| α-helix | 214 | 1 | |
| β-strand | 215 | 1 | 4 |
| β-strand | 216-220 | 5 | 3 |
| α-helix | 221-222 | 2 | |
| α-helix | 226-228 | 3 | |
| α-helix | 229-241 | 13 | |
| β-strand | 244-248 | 5 | 1 |
| α-helix | 257-266 | 10 | |
| β-strand | 271-275 | 5 | 1 |
| β-strand | 287-290 | 4 | 1 |
| α-helix | 293-300 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent protein deacylase sirtuin-5, mitochondrial | A | protein | 272 | Homo sapiens | Q9NXA8 (AlphaFold model) |
| Ace-his-phe-ser-sll | B | protein | 5 | synthetic construct |
>6LJN_1 NAD-dependent protein deacylase sirtuin-5, mitochondrial (chains A) QASARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLA FAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAG TKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEA GCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVP VAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>6LJN_2 ACE-HIS-PHE-SER-SLL (chains B) XHFSX
Sensitive fluorogenic substrates for sirtuin deacylase inhibitor discovery. Yang, L.L., Wang, H.L., Yan, Y.H. et al. Eur J Med Chem (2020) 192:112201-112201. DOI 10.1016/j.ejmech.2020.112201 · PubMed
Other PDB entries of the same protein (UniProt Q9NXA8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6LJN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.