9V0H: Human SIRT5

Crystal structure of human SIRT5 in complex with inhibitor 0904. Determined by X-ray diffraction at 1.67 Å resolution. Released 27 May 2026.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,775
Mol. weight: 59.88 kDa
Ligands: A1EQQ, ZN
Released: 27 May 2026

Explore 9V0H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9V0H contains 36 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	40-49	10
β-strand	52-57	6	1
α-helix	59-63	5
β-strand	77	1	2
β-strand	80	1	2
α-helix	82-85	4
α-helix	88-93	6
α-helix	95-108	14
α-helix	109-111	3
α-helix	116-130	15
β-strand	134-139	6	1
α-helix	145-149	5
β-strand	154-156	3	1
β-strand	159-166	8	3
β-strand	172-174	3	3
α-helix	182-184	3
α-helix	194-196	3
α-helix	201-203	3
β-strand	206	1	4
α-helix	214	1
β-strand	215	1	4
β-strand	216-220	5	3
α-helix	221-222	2
α-helix	226-228	3
α-helix	229-241	13
β-strand	244-248	5	1
α-helix	257-266	10
β-strand	271-275	5	1
α-helix	278-280	3
β-strand	287-290	4	1
α-helix	293-300	8

Chain B: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	40-49	10
β-strand	52-57	6	5
α-helix	59-63	5
β-strand	77	1	6
β-strand	80	1	6
α-helix	82-85	4
α-helix	88-93	6
α-helix	95-108	14
α-helix	109-111	3
α-helix	116-129	14
β-strand	134-139	6	5
α-helix	145-149	5
β-strand	154-156	3	5
β-strand	159-166	8	7
β-strand	172-174	3	7
α-helix	182-184	3
α-helix	194-196	3
α-helix	201-203	3
β-strand	206	1	8
α-helix	214	1
β-strand	215	1	8
β-strand	216-220	5	7
α-helix	221-222	2
α-helix	226-228	3
α-helix	229-241	13
β-strand	244-248	5	5
α-helix	257-259	3
α-helix	261-266	6
β-strand	271-275	5	5
β-strand	287-290	4	5
α-helix	293-300	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NAD-dependent protein deacylase sirtuin-5, mitochondrial	A, B	protein	269	Homo sapiens	Q9NXA8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9V0H_1 NAD-dependent protein deacylase sirtuin-5, mitochondrial (chains A, B)
ARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAH
NPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKN
LLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCG
GLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE
FNTETTPATNRFRFHFQGPCGTTLPEALA

Ligands and cofactors

ID	Name	Formula	Copies
A1EQQ	3-[[(~{E})-1-[3-[[2-(6-ethoxypyridin-3-yl)-5-[[(1~{R})-1-phenylpropyl]carbamoyl…	C29 H36 N8 O6	2
ZN	Zinc ion	Zn	2

Primary citation

Crystal structure of human SIRT5 in complex with inhibitor 0904. Ying, L.L., Jiang, Y.Y. To be published.

Other PDB entries of the same protein (UniProt Q9NXA8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EQS 1.32 Å, Human Sirt5 in complex with stalled peptidylimidate intermediate of inhibitory compound 29
6LJK 1.39 Å, Crystal structure of human Sirt5 in complex with an internally quenched fluorescent…
8Z54 1.45 Å, Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment
5BWL 1.55 Å, Crystal Structure of SIRT5 in Complex with a Coumarin-Labelled Succinyl Peptide
3RIY 1.55 Å, Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase
7X3P 1.56 Å, Crystal structure of human SIRT5 in complex with diazirine inhibitor 9
4F56 1.7 Å, The bicyclic intermediate structure provides insights into the desuccinylation mechanism…
6ACO 1.71 Å, histone lysine desuccinylase Sirt5 in complex with succinyl peptide H2BK120
6LJM 1.78 Å, Crystal structure of human Sirt5 in complex with the fluorogenic tetrapeptide substrate…
6LJN 1.8 Å, Crystal structure of human Sirt5 in complex with the fluorogenic tetrapeptide substrate…
8Z56 1.81 Å, Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment
8Z55 1.83 Å, Crystal structure of human SIRT5 in complex with succPrx1 and ADP ribose

Browse structure collections

About this viewer

MolViewer shows 9V0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.