6LSB: DPF domain of MOZ

Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Nov 2020.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,228
Mol. weight: 17.93 kDa
Ligands: ZN
Released: 18 Nov 2020

Explore 6LSB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LSB contains 10 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	195-199	5
α-helix	203-206	4
β-strand	209	1	1
β-strand	215	1	2
β-strand	218	1	2
α-helix	226-227	2
β-strand	228-229	2	1
β-strand	236-237	2	1
α-helix	246-252	7
β-strand	265	1	3
α-helix	275-277	3
β-strand	279-280	2	3
β-strand	287-288	2	3
α-helix	290-292	3
α-helix	300-302	3

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	3
α-helix	4-11	8
α-helix	14-16	3
α-helix	17-24	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase KAT6A	A	protein	131	Homo sapiens	Q92794 (AlphaFold model)
Histone H3	B	protein	26	Homo sapiens	P22843 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LSB_1 Histone acetyltransferase KAT6A (chains A)
SLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRV
KALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
RKKGRKLLQKK

Sequence of entity 2 (B), FASTA

>6LSB_2 Histone H3 (chains B)
ARTKQTARKSTGGKAPRKQLATKAAX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Histone benzoylation serves as an epigenetic mark for DPF and YEATS family proteins. Ren, X., Zhou, Y., Xue, Z. et al. Nucleic Acids Res (2021) 49:114-126. DOI 10.1093/nar/gkaa1130 · PubMed

Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B78 1.4 Å, Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3…
3V43 1.47 Å, Crystal structure of MOZ
7Y43 1.5 Å, Crystal structure of the KAT6A WH domain and its bound double stranded DNA
5B77 1.55 Å, Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at…
4LK9 1.6 Å, Crystal Structure of MOZ double PHD finger histone H3 tail complex
4LKA 1.61 Å, Crystal Structure of MOZ double PHD finger histone H3K9ac complex
5B76 1.65 Å, Crystal structure of MOZ double PHD finger domain in complex with histone H3…
5B75 1.7 Å, Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14
9DZN 1.72 Å, KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor
8H7A 1.92 Å, Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA
9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…
29UQ 2.13 Å, KAT6A surface mutant in complex with co-factor acetyl-co-a

Browse structure collections

About this viewer

MolViewer shows 6LSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.